LOCUS       NM_001396685            2096 bp    mRNA    linear   VRT 13-OCT-2024
DEFINITION  Gallus gallus ISL LIM homeobox 2 (ISL2), transcript variant 2,
            mRNA.
ACCESSION   NM_001396685 XM_015279023
VERSION     NM_001396685.1
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 2096)
  AUTHORS   Tang,H., Finn,R.D. and Thomas,P.D.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 2096)
  AUTHORS   Burge,S., Kelly,E., Lonsdale,D., Mutowo-Muellenet,P., McAnulla,C.,
            Mitchell,A., Sangrador-Vegas,A., Yong,S.Y., Mulder,N. and Hunter,S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 2096)
  AUTHORS   Moret,F., Renaudot,C., Bozon,M. and Castellani,V.
  TITLE     Semaphorin and neuropilin co-expression in motoneurons sets axon
            sensitivity to environmental semaphorin sources during motor axon
            pathfinding
  JOURNAL   Development 134 (24), 4491-4501 (2007)
   PUBMED   18039974
REFERENCE   4  (bases 1 to 2096)
  AUTHORS   Sockanathan,S. and Jessell,T.M.
  TITLE     Motor neuron-derived retinoid signaling specifies the subtype
            identity of spinal motor neurons
  JOURNAL   Cell 94 (4), 503-514 (1998)
   PUBMED   9727493
REFERENCE   5  (bases 1 to 2096)
  AUTHORS   Tsuchida,T., Ensini,M., Morton,S.B., Baldassare,M., Edlund,T.,
            Jessell,T.M. and Pfaff,S.L.
  TITLE     Topographic organization of embryonic motor neurons defined by
            expression of LIM homeobox genes
  JOURNAL   Cell 79 (6), 957-970 (1994)
   PUBMED   7528105
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAENSK010000245.1.
            
            On Oct 25, 2021 this sequence version replaced XM_015279023.3.
            
            Transcript Variant: This variant (2) has five exons. It lacks the
            first intron found in the other variant. The fourth exon is the
            short variant.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns
                              SAMEA103992290, SAMEA103992440 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            inferred exon combination :: based on alignments, homology
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-722               JAENSK010000245.1  2912326-2913047     c
            723-973             JAENSK010000245.1  2911970-2912220     c
            974-1257            JAENSK010000245.1  2911532-2911815     c
            1258-1387           JAENSK010000245.1  2911285-2911414     c
            1388-2096           JAENSK010000245.1  2910484-2911192     c
FEATURES             Location/Qualifiers
     source          1..2096
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="10"
                     /map="10"
     gene            1..2096
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /note="ISL LIM homeobox 2"
                     /db_xref="CGNC:49781"
                     /db_xref="GeneID:396382"
     exon            1..722
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /inference="alignment:Splign:2.1.0"
     CDS             55..1785
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /note="domesticus (clone 1.6 kB) islet-2"
                     /codon_start=1
                     /product="insulin gene enhancer protein ISL-2"
                     /protein_id="NP_001383614.1"
                     /db_xref="CGNC:49781"
                     /db_xref="GeneID:396382"
                     /translation="

MSLFRFRLSPFLPSSSLSVFFPSRSFLVLSFRLRFFSVLPSFPPSPRSVLVFLRFCFYFHFRDPTFLSLSGLISHDFPQSTFSSEFPPLLPLPSRLFSFFPRSRLYFFLSLFQFCLKKKKQQNKTKTPNKPNQKPEPPKEQSPAARSLPPPLADAAAPAGRPGLALCAGCGGRIQDPFLLRVSPDLEWHVACLKCAECGQPLDETCTCFLRDGKAYCKRDYGRLFGIKCAQCRAAFSSSDLVMRARDHVYHLECFRCAACGRQLLPGDQFCLRERDLLCRADHGPPPDGAAARGPRSPAPPPAHLAEPVPGRPPGPRPQSHKAAEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKSILMKQLQQQQHSDKTPRPARERRAGQRGGGADLPAALEGAQRLRAAERPGAARRLPAAGLLLRVRLFGHVLRQRRDLAVLPAPRHPQQHGAQPGRDVRPPGPRRRGTSACRAPCMRHPAPRRAQRAGRAPLSFNYSYLKPNRTYLADGRKAPGFSLPSPDRREKERASPRPAHFVARRFGAADFDVSFPR"

     misc_feature    553..717
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /note="The first LIM domain of Isl, a member of LHX
                     protein family; Region: LIM1_Isl; cd09366"
                     /db_xref="CDD:188752"
     misc_feature    order(553..555,562..564,619..621,628..630,637..639,
                     646..648,703..705,712..714)
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:188752"
     misc_feature    739..903
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /note="LIM is a small protein-protein interaction domain,
                     containing two zinc fingers; Region: LIM; cl02475"
                     /db_xref="CDD:413332"
     misc_feature    order(739..741,748..750,805..807,814..816,823..825,
                     832..834,889..891,898..900)
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:259829"
     misc_feature    1033..1203
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /note="Homeodomain; Region: HOX; smart00389"
                     /db_xref="CDD:197696"
     misc_feature    order(1039..1050,1054..1056,1105..1107,1123..1125,
                     1162..1164,1168..1173,1180..1185,1189..1197,1201..1206)
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(1042..1044,1051..1053,1171..1173,1180..1185,
                     1192..1194)
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            723..973
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /inference="alignment:Splign:2.1.0"
     exon            974..1257
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /inference="alignment:Splign:2.1.0"
     exon            1258..1387
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /inference="alignment:Splign:2.1.0"
     exon            1388..2096
                     /gene="ISL2"
                     /gene_synonym="ISLET-2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

tttctctttctgttcttccgtttttgtttggggttatttctctctctctgcccgatgtctcttttccgttttcgtttgtcccctttcctgccctcatcctctctttccgtttttttcccttcgcgctcctttctcgttctgtcgttccgtcttcggttcttctccgttcttccctcctttccgccttccccccgttctgtattggtctttctgcggttctgcttttatttccacttccgagatcccacttttctgtctctttctgggctgatttcccacgatttcccccagtcaactttctcctcggaattcccaccgctccttcctctcccgtcgcggctcttttctttctttccccgttcccgtctgtatttctttctttctctctttcaattttgcttaaaaaaaaaaaaacaacaaaacaaaaccaaaaccccaaacaaacccaaccaaaaacccgaacccccaaaagaacaaagccccgcagcccgcagcctccccccgccgctcgctgacgccgcggctcccgcaggacggccggggctggcgctgtgcgcgggctgcggcggccgcatccaggacccgttcctgctgcgggtgtctccggacctggagtggcacgtcgcctgcctcaagtgcgccgagtgcgggcagccgctggacgagacctgcacgtgcttcctgcgcgacggcaaggcctactgcaagcgggactacggcaggctcttcggcatcaagtgcgcgcagtgccgggcggccttcagcagcagcgacctggtgatgcgcgcccgcgaccacgtctaccacctggagtgcttccgctgcgccgcctgcggccgccagctgctgcccggggatcagttctgcctgcgggagcgcgacctgctctgccgcgccgaccacgggccgccccccgacggcgccgccgcccgcgggccccgcagccccgcgccgccgcccgcgcacctcgcagagccggtgcccggacggccgcccggcccgcggccgcagtcgcacaaagcggccgagaagaccacccgcgtgcggacggtgctgaacgagaagcagctgcacacgctgcggacctgctacgccgccaacccgagacccgacgccctgatgaaggagcagctggtggagatgacggggctcagcccgcgcgtcatccgcgtctggttccagaacaagcgctgcaaggacaagaagaagtccatcctcatgaagcagctccagcagcagcagcacagcgacaagacgccccgtccggcacgagagcgccgtgcagggcagcgcggtggaggtgcagacctaccagccgccctggaaggcgctcagcgacttcgcgctgcagagcgacctggagccgcccgccgccttccagcagctggtctccttctccgagtccggctctttgggcacgtcctccggcagcgacgtgacctcgctgtcctcccagctccccgacacccccaacagcatggtgcccagcccggccgagacgtgaggccgcccggcccccgccgccgcgggacctccgcatgccgcgctccctgcatgagacacccggccccgcgccgcgcccagcgcgccggacgagcgcctttgtcttttaattattcctatttaaaaccaaaccgaacgtaccttgccgacggccgaaaagcgccgggattctcgctgccttcaccggaccggagagagaaagagagagcgagcccccgccccgctcatttcgttgcgcggaggttcggcgctgcggatttcgatgtttcttttccgcgatgaaagcggattgcccggcggggcgccggctcttcctcctcgcctggaacagaaacgaaaactcgaatcaaaccgaacgggggtcggagccccgcggccgtcgcggccgcctcacgccggcgcctcccgcagcaccgcggcgcggagacggggcgctgcgacgggacagcgctgccggcgatagcgacggacggagggcggattgtttgagcctttaaacgaacaaaagtaagttattgctatttattgtcagagtcagcggttgaatagtggggttaaatattttggacttaataaaaacaaacgaacaacaa

//