ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-06-23 19:13:44, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001396684 1789 bp mRNA linear VRT 20-NOV-2025 DEFINITION Gallus gallus ISL LIM homeobox 2 (ISL2), mRNA. ACCESSION NM_001396684 XM_015279026 XM_040680536 VERSION NM_001396684.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 1789) AUTHORS Tang,H., Finn,R.D. and Thomas,P.D. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 1789) AUTHORS Burge,S., Kelly,E., Lonsdale,D., Mutowo-Muellenet,P., McAnulla,C., Mitchell,A., Sangrador-Vegas,A., Yong,S.Y., Mulder,N. and Hunter,S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1789) AUTHORS Moret,F., Renaudot,C., Bozon,M. and Castellani,V. TITLE Semaphorin and neuropilin co-expression in motoneurons sets axon sensitivity to environmental semaphorin sources during motor axon pathfinding JOURNAL Development 134 (24), 4491-4501 (2007) PUBMED 18039974 REFERENCE 4 (bases 1 to 1789) AUTHORS Sockanathan,S. and Jessell,T.M. TITLE Motor neuron-derived retinoid signaling specifies the subtype identity of spinal motor neurons JOURNAL Cell 94 (4), 503-514 (1998) PUBMED 9727493 REFERENCE 5 (bases 1 to 1789) AUTHORS Tsuchida,T., Ensini,M., Morton,S.B., Baldassare,M., Edlund,T., Jessell,T.M. and Pfaff,S.L. TITLE Topographic organization of embryonic motor neurons defined by expression of LIM homeobox genes JOURNAL Cell 79 (6), 957-970 (1994) PUBMED 7528105 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000245.1. On or before Oct 25, 2021 this sequence version replaced XM_015279026.3, XM_040680536.1. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns SAMEA103992290, SAMEA103992440 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## inferred exon combination :: based on alignments, homology ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-184 JAENSK010000245.1 2913317-2913500 c 185-374 JAENSK010000245.1 2912326-2912515 c 375-625 JAENSK010000245.1 2911970-2912220 c 626-909 JAENSK010000245.1 2911532-2911815 c 910-1080 JAENSK010000245.1 2911285-2911455 c 1081-1789 JAENSK010000245.1 2910484-2911192 c FEATURES Location/Qualifiers source 1..1789 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="10" /map="10" gene 1..1789 /gene="ISL2" /gene_synonym="ISLET-2" /note="ISL LIM homeobox 2" /db_xref="CGNC:49781" /db_xref="GeneID:396382" exon 1..184 /gene="ISL2" /gene_synonym="ISLET-2" /inference="alignment:Splign:2.1.0" CDS 127..1197 /gene="ISL2" /gene_synonym="ISLET-2" /note="domesticus (clone 1.6 kB) islet-2" /codon_start=1 /product="insulin gene enhancer protein ISL-2" /protein_id="NP_001383613.1" /db_xref="CGNC:49781" /db_xref="GeneID:396382" /translation="
MVDILLPRPLPSAMGEPAKRRPGLALCAGCGGRIQDPFLLRVSPDLEWHVACLKCAECGQPLDETCTCFLRDGKAYCKRDYGRLFGIKCAQCRAAFSSSDLVMRARDHVYHLECFRCAACGRQLLPGDQFCLRERDLLCRADHGPPPDGAAARGPRSPAPPPAHLAEPVPGRPPGPRPQSHKAAEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKSILMKQLQQQQHSDKTSLQGLTGTPLVAGSPVRHESAVQGSAVEVQTYQPPWKALSDFALQSDLEPPAAFQQLVSFSESGSLGTSSGSDVTSLSSQLPDTPNSMVPSPAET"
misc_feature 205..369
/gene="ISL2"
/gene_synonym="ISLET-2"
/note="The first LIM domain of Isl, a member of LHX
protein family; Region: LIM1_Isl; cd09366"
/db_xref="CDD:188752"
misc_feature order(205..207,214..216,271..273,280..282,289..291,
298..300,355..357,364..366)
/gene="ISL2"
/gene_synonym="ISLET-2"
/note="Zn binding site [ion binding]; other site"
/db_xref="CDD:188752"
misc_feature 391..555
/gene="ISL2"
/gene_synonym="ISLET-2"
/note="The second LIM domain of Isl2; Region: LIM2_Isl2;
cd09471"
/db_xref="CDD:188855"
misc_feature order(391..393,400..402,457..459,466..468,475..477,
484..486,541..543,550..552)
/gene="ISL2"
/gene_synonym="ISLET-2"
/note="Zn binding site [ion binding]; other site"
/db_xref="CDD:188855"
misc_feature 685..855
/gene="ISL2"
/gene_synonym="ISLET-2"
/note="Homeodomain; Region: HOX; smart00389"
/db_xref="CDD:197696"
misc_feature order(691..702,706..708,757..759,775..777,814..816,
820..825,832..837,841..849,853..858)
/gene="ISL2"
/gene_synonym="ISLET-2"
/note="DNA binding site [nucleotide binding]"
/db_xref="CDD:238039"
misc_feature order(694..696,703..705,823..825,832..837,844..846)
/gene="ISL2"
/gene_synonym="ISLET-2"
/note="specific DNA base contacts [nucleotide binding];
other site"
/db_xref="CDD:238039"
exon 185..374
/gene="ISL2"
/gene_synonym="ISLET-2"
/inference="alignment:Splign:2.1.0"
exon 375..625
/gene="ISL2"
/gene_synonym="ISLET-2"
/inference="alignment:Splign:2.1.0"
exon 626..909
/gene="ISL2"
/gene_synonym="ISLET-2"
/inference="alignment:Splign:2.1.0"
exon 910..1080
/gene="ISL2"
/gene_synonym="ISLET-2"
/inference="alignment:Splign:2.1.0"
exon 1081..1789
/gene="ISL2"
/gene_synonym="ISLET-2"
/inference="alignment:Splign:2.1.0"
ORIGIN
gctgcccggcggggcgggcccgggggggcgggcgcggcccccgccccgcgcggagcgggtagtggtggagcggcggcgccgcgtcccgcatcgcgcatcgccgccggtgcgcacggggccgcccgcatggtggacatcctcctgccgcggccgctcccgagcgccatgggggagcccgccaagagacggccggggctggcgctgtgcgcgggctgcggcggccgcatccaggacccgttcctgctgcgggtgtctccggacctggagtggcacgtcgcctgcctcaagtgcgccgagtgcgggcagccgctggacgagacctgcacgtgcttcctgcgcgacggcaaggcctactgcaagcgggactacggcaggctcttcggcatcaagtgcgcgcagtgccgggcggccttcagcagcagcgacctggtgatgcgcgcccgcgaccacgtctaccacctggagtgcttccgctgcgccgcctgcggccgccagctgctgcccggggatcagttctgcctgcgggagcgcgacctgctctgccgcgccgaccacgggccgccccccgacggcgccgccgcccgcgggccccgcagccccgcgccgccgcccgcgcacctcgcagagccggtgcccggacggccgcccggcccgcggccgcagtcgcacaaagcggccgagaagaccacccgcgtgcggacggtgctgaacgagaagcagctgcacacgctgcggacctgctacgccgccaacccgagacccgacgccctgatgaaggagcagctggtggagatgacggggctcagcccgcgcgtcatccgcgtctggttccagaacaagcgctgcaaggacaagaagaagtccatcctcatgaagcagctccagcagcagcagcacagcgacaagacgagcctgcagggcctcaccgggacgccgctggtggccggcagccccgtccggcacgagagcgccgtgcagggcagcgcggtggaggtgcagacctaccagccgccctggaaggcgctcagcgacttcgcgctgcagagcgacctggagccgcccgccgccttccagcagctggtctccttctccgagtccggctctttgggcacgtcctccggcagcgacgtgacctcgctgtcctcccagctccccgacacccccaacagcatggtgcccagcccggccgagacgtgaggccgcccggcccccgccgccgcgggacctccgcatgccgcgctccctgcatgagacacccggccccgcgccgcgcccagcgcgccggacgagcgcctttgtcttttaattattcctatttaaaaccaaaccgaacgtaccttgccgacggccgaaaagcgccgggattctcgctgccttcaccggaccggagagagaaagagagagcgagcccccgccccgctcatttcgttgcgcggaggttcggcgctgcggatttcgatgtttcttttccgcgatgaaagcggattgcccggcggggcgccggctcttcctcctcgcctggaacagaaacgaaaactcgaatcaaaccgaacgggggtcggagccccgcggccgtcgcggccgcctcacgccggcgcctcccgcagcaccgcggcgcggagacggggcgctgcgacgggacagcgctgccggcgatagcgacggacggagggcggattgtttgagcctttaaacgaacaaaagtaagttattgctatttattgtcagagtcagcggttgaatagtggggttaaatattttggacttaataaaaacaaacgaacaacaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]