2024-04-28 20:57:27, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001351438 542 bp mRNA linear VRT 23-SEP-2021 DEFINITION Gallus gallus NK2 homeobox 3 (NKX2-3), mRNA. ACCESSION NM_001351438 VERSION NM_001351438.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 542) AUTHORS Strasser B, Mlitz V, Hermann M, Rice RH, Eigenheer RA, Alibardi L, Tschachler E and Eckhart L. TITLE Evolutionary origin and diversification of epidermal barrier proteins in amniotes JOURNAL Mol Biol Evol 31 (12), 3194-3205 (2014) PUBMED 25169930 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000349.1. On Sep 23, 2021 this sequence version replaced NM_001351438.1. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##Evidence-Data-START## Transcript exon combination :: BX257576.4, BX257577.4 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992428, SAMEA103992559 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-45 JAENSK010000349.1 823801-823845 46-542 JAENSK010000349.1 824923-825419 FEATURES Location/Qualifiers source 1..542 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="25" /map="25" gene 1..542 /gene="NKX2-3" /gene_synonym="EDQM3; NKx-2.3" /note="NK2 homeobox 3" /db_xref="CGNC:80606" /db_xref="GeneID:110224122" exon 1..45 /gene="NKX2-3" /gene_synonym="EDQM3; NKx-2.3" /inference="alignment:Splign:2.1.0" exon 46..542 /gene="NKX2-3" /gene_synonym="EDQM3; NKx-2.3" /inference="alignment:Splign:2.1.0" misc_feature 57..59 /gene="NKX2-3" /gene_synonym="EDQM3; NKx-2.3" /note="upstream in-frame stop codon" CDS 66..326 /gene="NKX2-3" /gene_synonym="EDQM3; NKx-2.3" /codon_start=1 /product="epidermal differentiation protein containing a glutamine (Q) motif 3" /protein_id="NP_001338367.1" /db_xref="CGNC:80606" /db_xref="GeneID:110224122" /translation="
MCSRADRGCHSSESSSCHSGGSSCHGSEEVTCHEVSAVQDGTPVVVLQPQCPVVTVPTQGPVAPVPCQQQQQQIKQPVQWPTQQQK"
ORIGIN
tcattcactcggctccgttccctctgagcaacctttccagacaagggctcctgctctgatcgaagatgtgctcccgtgctgacagaggctgccacagctctgagagctcctcctgccacagcggaggttcctcctgccatggctctgaggaggtcacctgccacgaagtgagcgccgtgcaggatgggacgcccgtggtggtcctgcagcctcagtgccctgtggtcaccgtgcccactcagggccccgtggctcccgtcccatgccagcagcaacagcaacagatcaagcagccggtgcaatggcccacgcagcagcagaagtgaaggggctgcgctcatccctcatctctgcagggcacagccctgagcagcaggagcagctcctgcccctcccctccagcacatattgcctctcctgatgctgtgacggagcgttggcacgtcagaaatgtgatttgcccacttgcatttgtatccgttattttcctgcttctgtatccagtagcaaagacgtgatattaaaatgtaaagctcacaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]