2024-05-03 12:16:35, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001199393 1702 bp mRNA linear VRT 24-SEP-2023 DEFINITION Gallus gallus centrosomal protein 41 (CEP41), mRNA. ACCESSION NM_001199393 XM_414980 VERSION NM_001199393.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 1702) AUTHORS Tang H, Finn RD and Thomas PD. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 1702) AUTHORS Savolainen P, Fitzsimmons C, Arvestad L, Andersson L and Lundeberg J. TITLE ESTs from brain and testis of White Leghorn and red junglefowl: annotation, bioinformatic classification of unknown transcripts and analysis of expression levels JOURNAL Cytogenet Genome Res 111 (1), 79-87 (2005) PUBMED 16093725 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000006.1. On Dec 3, 2021 this sequence version replaced NM_001199393.1. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combination :: HAEK01023890.1, HAEK01046653.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992290 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-91 JAENSK010000006.1 590942-591032 c 92-155 JAENSK010000006.1 590413-590476 c 156-203 JAENSK010000006.1 589502-589549 c 204-265 JAENSK010000006.1 586866-586927 c 266-335 JAENSK010000006.1 586429-586498 c 336-480 JAENSK010000006.1 585819-585963 c 481-632 JAENSK010000006.1 585482-585633 c 633-700 JAENSK010000006.1 585127-585194 c 701-815 JAENSK010000006.1 584173-584287 c 816-1031 JAENSK010000006.1 583777-583992 c 1032-1702 JAENSK010000006.1 582708-583378 c FEATURES Location/Qualifiers source 1..1702 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="1" /map="1" gene 1..1702 /gene="CEP41" /gene_synonym="TSGA14" /note="centrosomal protein 41" /db_xref="CGNC:6138" /db_xref="GeneID:416684" exon 1..91 /gene="CEP41" /gene_synonym="TSGA14" /inference="alignment:Splign:2.1.0" CDS 59..1162 /gene="CEP41" /gene_synonym="TSGA14" /note="testis specific, 14; centrosomal protein 41kDa" /codon_start=1 /product="centrosomal protein of 41 kDa" /protein_id="NP_001186322.2" /db_xref="CGNC:6138" /db_xref="GeneID:416684" /translation="
MSSRRSVGDPEYLTRRIPQNPRYQHIKTRLDTGSSLTKYIEKLEEIKRNYRYRKDELFKRLKVTTFAQLVVQVASLSDETLEVTNEEIHKLEGGNSPASDADAELTAGTNGKGSPNGTPPSPVLFINNTGAGESYRSTLQSLISGVGELDIEKDTHKKADTQAKDTPYPDCPFLLLDVRDRDAYDQCHIVGAYSYPIAMLSRAMNPYTNSILEYKNAHGKIIILYDDDERLASQAATTMCERGFENLFMLSGGLKVLAQKVPEGLITGSLPISCQVAAPTGSARKKPVPKVPPTRAESKWRYSAEDLQKIKYYLEEEQLPSDTASRLSRGSSGRDSKATTARSSPSLPSTAGSRMLSRSSIQNRPWK"
misc_feature 566..823 /gene="CEP41" /gene_synonym="TSGA14" /note="Rhodanese-like domain; Region: Rhodanese; pfam00581" /db_xref="CDD:425764" misc_feature 734..736 /gene="CEP41" /gene_synonym="TSGA14" /note="active site residue [active]" /db_xref="CDD:238089" exon 92..155 /gene="CEP41" /gene_synonym="TSGA14" /inference="alignment:Splign:2.1.0" exon 156..203 /gene="CEP41" /gene_synonym="TSGA14" /inference="alignment:Splign:2.1.0" exon 204..265 /gene="CEP41" /gene_synonym="TSGA14" /inference="alignment:Splign:2.1.0" exon 266..335 /gene="CEP41" /gene_synonym="TSGA14" /inference="alignment:Splign:2.1.0" exon 336..480 /gene="CEP41" /gene_synonym="TSGA14" /inference="alignment:Splign:2.1.0" exon 481..632 /gene="CEP41" /gene_synonym="TSGA14" /inference="alignment:Splign:2.1.0" exon 633..700 /gene="CEP41" /gene_synonym="TSGA14" /inference="alignment:Splign:2.1.0" exon 701..815 /gene="CEP41" /gene_synonym="TSGA14" /inference="alignment:Splign:2.1.0" exon 816..1031 /gene="CEP41" /gene_synonym="TSGA14" /inference="alignment:Splign:2.1.0" exon 1032..1702 /gene="CEP41" /gene_synonym="TSGA14" /inference="alignment:Splign:2.1.0" ORIGIN
aggggcagacagagccggacggcgggaggcggcggagcgtgagaagcgttgtgggacgatgtcgagcaggaggagcgtcggtgaccccgagtacttaaccaggcgcatccctcagaacccccggtaccaacacatcaaaacccgcctcgataccgggagcagtctgacaaaatacattgagaagttggaggaaatcaaaagaaattacaggtacagaaaggacgagctgtttaaaagactgaaagtgactacttttgcccaactggttgttcaggttgcttctctgtctgatgaaaccttagaagtgacgaatgaggagatccacaagctggaaggtggcaattctcctgcttcagacgcagatgctgagctcacagcggggacaaatggcaaagggagccccaatgggacaccccccagtcctgtcctgttcataaacaacaccggagctggagaatcgtatcggtccacactgcagagtttgataagcggtgtcggtgaattggatatagaaaaggacactcataagaaagcagacacccaggcgaaggatactccttatcctgactgccccttcctgctgttagacgtacgagaccgcgatgcttacgaccagtgtcacatagttggagcttattcttatcctattgcaatgctgtctagagccatgaatccatatacaaacagtattctggaatataaaaatgcccatggaaagattataattctgtacgacgacgacgagcggctcgccagccaggctgccaccaccatgtgtgagaggggctttgagaacttgttcatgttgtctggagggctcaaggtgcttgcacagaaggtcccggaaggactcatcaccggctcgctccccatttcctgccaggtggcagctcccacagggtctgcccgaaaaaagcctgttcccaaagtgccacccacgcgtgctgagagcaaatggaggtactctgcagaagatctgcagaagattaagtactacctcgaagaggagcagcttccttcagacactgccagtcgccttagccgtggctcttcgggacgtgattccaaagcaacaacagcacggagcagccccagcctccccagcacagcgggatcccgcatgctcagcaggagcagcatccagaacaggccatggaaataagcagctgtgtctccttccactgaataaatgagcgtccaggttctgggaaccctgagcagtgcagccctgtttgtcattttaggaattcacggaggaaagcggtggtgatgtataaatggcagcttgggtaaggctggggagacggaagggttgatgtgatgtcttgtaggagcagtgtcacgttggccaagtgaccttcaggacaggtttttgtaggggaggggggaaaactggtagtgaagcctgtgaccaagtagcaatggatctgaaagacctgcagttcagactaaggaattgtgtctgtagcaaaccttcctctgtgctgggctcagagctgcaggctgtgctaacagtgagaagaaattgatcagaaaattgtgagcagaaaccgtggcgttctgtggcagggatggacattcagcaaattgccaaaatggtggagagagaggattccaaatctctcttttttttttttttatttatgttaacgagcagaagtgtttgtaataaagatgttttgggaaataacgaccagcgtgg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]