LOCUS       NM_001139477            1230 bp    mRNA    linear   VRT 19-SEP-2023
DEFINITION  Gallus gallus Meis homeobox 1 (MEIS1), mRNA.
ACCESSION   NM_001139477
VERSION     NM_001139477.1
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1230)
  AUTHORS   Tang H, Finn RD and Thomas PD.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 1230)
  AUTHORS   Sanchez-Guardado LO, Irimia M, Sanchez-Arrones L, Burguera D,
            Rodriguez-Gallardo L, Garcia-Fernandez J, Puelles L, Ferran JL and
            Hidalgo-Sanchez M.
  TITLE     Distinct and redundant expression and transcriptional diversity of
            MEIS gene paralogs during chicken development
  JOURNAL   Dev Dyn 240 (6), 1475-1492 (2011)
   PUBMED   21465619
  REMARK    GeneRIF: Detailed analysis of chick Meis1/2 expression patterns
            during early embryogenesis and organogenesis.
REFERENCE   3  (bases 1 to 1230)
  AUTHORS   Sanchez-Guardado LO, Ferran JL, Rodriguez-Gallardo L, Puelles L and
            Hidalgo-Sanchez M.
  TITLE     Meis gene expression patterns in the developing chicken inner ear
  JOURNAL   J Comp Neurol 519 (1), 125-147 (2011)
   PUBMED   21120931
  REMARK    GeneRIF: Our results suggest a possible role of Meis assigning
            regional identity in the morphogenesis, patterning, and
            specification of the developing inner ear.
REFERENCE   4  (bases 1 to 1230)
  AUTHORS   Mercader N, Leonardo E, Azpiazu N, Serrano A, Morata G, Martinez C
            and Torres M.
  TITLE     Conserved regulation of proximodistal limb axis development by
            Meis1/Hth
  JOURNAL   Nature 402 (6760), 425-429 (1999)
   PUBMED   10586884
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from FJ265709.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: FJ265709.1, SRR13267649.18528.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992290, SAMEA103992323
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1230
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="3"
                     /map="3"
     gene            1..1230
                     /gene="MEIS1"
                     /note="Meis homeobox 1"
                     /db_xref="CGNC:49389"
                     /db_xref="GeneID:395589"
     exon            1..61
                     /gene="MEIS1"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    23..25
                     /gene="MEIS1"
                     /note="upstream in-frame stop codon"
     CDS             50..1222
                     /gene="MEIS1"
                     /note="myeloid ecotropic viral insertion site-1a protein"
                     /codon_start=1
                     /product="homeobox protein Meis1"
                     /protein_id="NP_001132949.1"
                     /db_xref="CGNC:49389"
                     /db_xref="GeneID:395589"
                     /translation="

MAQRYDELPHYGGMEGVGIPTTMYGDPHGARPMRPVHHLNHGPPLHSHQYPHAAHANAMPPAMGASVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDGTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM"

     misc_feature    371..625
                     /gene="MEIS1"
                     /note="N-terminal of Homeobox Meis and PKNOX1; Region:
                     Meis_PKNOX_N; pfam16493"
                     /db_xref="CDD:465140"
     misc_feature    order(881..883,1010..1012,1019..1024,1031..1033)
                     /gene="MEIS1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    920..1036
                     /gene="MEIS1"
                     /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920"
                     /db_xref="CDD:428673"
     exon            62..288
                     /gene="MEIS1"
                     /inference="alignment:Splign:2.1.0"
     exon            289..430
                     /gene="MEIS1"
                     /inference="alignment:Splign:2.1.0"
     exon            431..481
                     /gene="MEIS1"
                     /inference="alignment:Splign:2.1.0"
     exon            482..532
                     /gene="MEIS1"
                     /inference="alignment:Splign:2.1.0"
     exon            533..679
                     /gene="MEIS1"
                     /inference="alignment:Splign:2.1.0"
     exon            680..791
                     /gene="MEIS1"
                     /inference="alignment:Splign:2.1.0"
     exon            792..937
                     /gene="MEIS1"
                     /inference="alignment:Splign:2.1.0"
     exon            938..1014
                     /gene="MEIS1"
                     /inference="alignment:Splign:2.1.0"
     exon            1015..1073
                     /gene="MEIS1"
                     /inference="alignment:Splign:2.1.0"
     exon            1074..1163
                     /gene="MEIS1"
                     /inference="alignment:Splign:2.1.0"
     exon            1164..1230
                     /gene="MEIS1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

tcacggaggatttattagaagttgaagtagaaagggagcgagcaggccgatggcgcaaaggtacgacgagctgccccactacggcggcatggagggggtgggcatccccaccaccatgtacggggacccgcacggcgcccgccccatgcggcccgtgcaccacctgaaccacgggccgccgctccactcgcaccagtacccgcacgccgcccacgccaacgccatgccccccgccatgggcgcctcggtcaacgatgccctcaagagagataaagatgccatctacggacaccccctgttccctcttttagcactgatttttgagaaatgtgaattagccacatgcacgcccagggagcccggggtagcgggaggcgatgtttgctcctccgagtctttcaatgaagacatagcagtgttcgccaaacagatccgagcagagaaacccctcttttcctctaatcccgaactggataacttgatgatccaagccatacaagtattaaggtttcatctgttggaattagagaaggtacacgaattatgtgacaatttctgccaccggtatattagctgtttgaaaggaaaaatgcctatcgatttggtcatagacgatagagagggcggatcaaaatcggacagcgaggacataacgcggtcggcaaacctcaccgatcagccctcctggaacagagaccacgacggcacggcatcaacgcgctccgggggaacccccgggccctccagtgggggacacacatcacacagtggggacaacagcagtgagcaaggtgacggcttggacaacagtgtagcttcccccagcacaggtgatgatgatgatccagataaggacaaaaagcgacataaaaagcgtggcatctttcccaaagtagccacaaatatcatgagggcatggctgttccagcatctaacacacccttacccttcagaagaacagaaaaagcagttggcacaagacacagggctcactatacttcaagtgaacaattggtttattaatgctagaagaagaatagttcagcccatgatagaccagtccaatcgagcagtaagccaagggacgccctacaaccccgacgggcagccaatgggaggcttcgtgatggatggccagcagcacatgggcatccgagcgccaggacctatgagtggaatgggcatgaatatgggcatggaggggcagtggcactacatgtaaccttcacc

//