LOCUS       NM_001080890            1681 bp    mRNA    linear   VRT 23-SEP-2023
DEFINITION  Gallus gallus distal-less homeobox 6 (DLX6), mRNA.
ACCESSION   NM_001080890 XM_001234460 XM_015281592
VERSION     NM_001080890.2
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1681)
  AUTHORS   Tang H, Finn RD and Thomas PD.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 1681)
  AUTHORS   Quach A, MacKenzie RK and Bendall AJ.
  TITLE     Measuring inputs to a common function: The case of Dlx5 and Dlx6
  JOURNAL   Biochem Biophys Res Commun 478 (1), 371-377 (2016)
   PUBMED   27416760
  REMARK    GeneRIF: We find Dlx5 and Dlx6 to be quantitatively
            indistinguishable on a variety of natural cis-regulatory sequences
            in a heterologous cellular context but observed quantitatively
            different transcriptional outputs in cells that normally express
            these genes, suggesting differential interactions with co-evolved
            co-activators.
REFERENCE   3  (bases 1 to 1681)
  AUTHORS   Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C,
            Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1681)
  AUTHORS   Gitton Y, Benouaiche L, Vincent C, Heude E, Soulika M, Bouhali K,
            Couly G and Levi G.
  TITLE     Dlx5 and Dlx6 expression in the anterior neural fold is essential
            for patterning the dorsal nasal capsule
  JOURNAL   Development 138 (5), 897-903 (2011)
   PUBMED   21270050
  REMARK    GeneRIF: ectethmoid formation depends upon Dlx5 and Dlx6 expression
            in a restricted ectodermal territory of the anterior neural folds
REFERENCE   5  (bases 1 to 1681)
  AUTHORS   Ferrari D and Kosher RA.
  TITLE     Expression of Dlx5 and Dlx6 during specification of the elbow joint
  JOURNAL   Int J Dev Biol 50 (8), 709-713 (2006)
   PUBMED   17051482
  REMARK    GeneRIF: Dlx5 and 6 genes may be involved in specification of the
            elbow joint and/or in providing positional information that
            specifies the site at which the elbow joint will form
REFERENCE   6  (bases 1 to 1681)
  AUTHORS   Brown ST, Wang J and Groves AK.
  TITLE     Dlx gene expression during chick inner ear development
  JOURNAL   J Comp Neurol 483 (1), 48-65 (2005)
   PUBMED   15672396
  REMARK    GeneRIF: Inner ear expression patterns of Dlx3, Dlx5, and Dlx6 were
            examined during the first 7 days of chicken embryonic development.
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAENSK010000036.1.
            
            On or before Oct 17, 2021 this sequence version replaced
            XM_015281592.3, NM_001080890.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: CD218909.1, CD215909.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992290, SAMEA103992544
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-440               JAENSK010000036.1  16495304-16495743
            441-634             JAENSK010000036.1  16496240-16496433
            635-1681            JAENSK010000036.1  16497779-16498825
FEATURES             Location/Qualifiers
     source          1..1681
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="2"
                     /map="2"
     gene            1..1681
                     /gene="DLX6"
                     /note="distal-less homeobox 6"
                     /db_xref="CGNC:16126"
                     /db_xref="GeneID:772070"
     exon            1..440
                     /gene="DLX6"
                     /inference="alignment:Splign:2.1.0"
     CDS             83..886
                     /gene="DLX6"
                     /note="homeodomain transcription factor DLX6"
                     /codon_start=1
                     /product="homeobox protein DLX-6"
                     /protein_id="NP_001074359.2"
                     /db_xref="CGNC:16126"
                     /db_xref="GeneID:772070"
                     /translation="

MMTMTTMADGLDAQDSSKSAFMEFGQQQPPPQPPPPPHSQQSSPAMAGAHYPLHCLHSAAGSHPHHQHHHHSSPYSGTGGSYNHRSLAAYPYVSHSQHSPYLQSYHTSGAPSQTRPDDADQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHESDPLPGSAALSPRSPALPPVWDVSASAKGVNMPPNSYMPGYSHWYSSPHQDTMQRPQMM"

     misc_feature    506..676
                     /gene="DLX6"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            441..634
                     /gene="DLX6"
                     /inference="alignment:Splign:2.1.0"
     exon            635..1681
                     /gene="DLX6"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

cggtgccgcggcggtggccgggcagggcggccgggcgcggggggcgagccggagagcctcgctctctgcctccccgccgtcgatgatgaccatgaccacgatggctgacgggttggacgcgcaggactcctccaaatccgccttcatggagttcgggcagcagcagccgccgccgcagccgccgccgccgccccactcgcagcagagctcgccggccatggccggagcgcactacccgctgcactgcctgcactccgccgccggctcgcacccgcaccaccagcaccaccaccacagctcgccctactccggcaccggcggctcctacaaccaccgctcgctcgccgcctacccctacgtgagccactcgcagcacagcccctacctgcagtcctaccacaccagcggcgcgcccagccagacgcggccggacgacgcagatcagcagaaaacgacggtgatcgaaaacggcgagatcagattcaacgggaaagggaaaaagatccggaagccccgaaccatttactccagccttcagctgcaggcgttaaaccaccgcttccagcagactcagtacctggcgctcccggagcgagccgagctggcggcctccctcggcctgacccagacgcaggtgaagatctggttccagaacaagcgctccaagtttaagaagctgctgaagcagggcagcaacccccacgagagcgaccctctgcccggctccgccgcgctgtccccgcgctccccggcgctgccgcccgtctgggacgtttcggcgtctgccaagggggtcaacatgccccccaacagctacatgcccggctattcccactggtactcctctccacaccaagacacaatgcagagaccgcagatgatgtgaactgtccgagacgacccacggcccgaggacgcccggcgcggcccggcccgaacggagcggcggtgcgggggggggttcgccttttgtttgtttcctttttttgaagtaacctcagcgatcgctcacgggcagaacgagccacgtcccactgcggcgcgggggagacgcttctctacgttcgctcggaccgcggggcaccgccgcctctttctgcgcggagcgcgcggacttttggctgacttcgccctccagaaagacccgaaccgcagcggggccgtctctctgtgttccgtgagctgtggacgctgcgcggtgagagaccgctccgagctccctcactgtcattccccgaacgcggaaggggggaaaacgtgaaacggggagaggaaaggaggggtaacgaaacgaagagggggggggaattaaaataaaaagaactggttgcgagtgaaaacgtacggcgagctcggagcgcggccgcgcagcgcggactgcacgcgtacgggtagcggctgcagcccgacgggagccgcgcggagtgccgccgggagccccgcaccctgcgagccccggcggaccgacggccggccggccggtcggactgacgggcgtacagccggactgacagccggactgacggacagccggacccgcggagcagcccggcaccccgctcctgctgctggacctccctcccgagcgacctttctgtatatattgttgaattttagctgtacataatactttgtatggtttggtctcctttcatatctagagtaaaagccaccgagcgcc

//