2025-07-23 21:52:46, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001030346 1772 bp mRNA linear VRT 08-APR-2024 DEFINITION Gallus gallus homeobox A4 (HOXA4), mRNA. ACCESSION NM_001030346 XM_418728 VERSION NM_001030346.3 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 1772) AUTHORS Tang,H., Finn,R.D. and Thomas,P.D. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 1772) AUTHORS Burge,S., Kelly,E., Lonsdale,D., Mutowo-Muellenet,P., McAnulla,C., Mitchell,A., Sangrador-Vegas,A., Yong,S.Y., Mulder,N. and Hunter,S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1772) AUTHORS Scotting,P.J., Hewitt,M. and Keynes,R.J. TITLE Isolation and analysis of chick homeobox cDNA clones JOURNAL Nucleic Acids Res 18 (13), 3999 (1990) PUBMED 1973835 REFERENCE 4 (bases 1 to 1772) AUTHORS Sasaki,H., Yokoyama,E. and Kuroiwa,A. TITLE Specific DNA binding of the two chicken Deformed family homeodomain proteins, Chox-1.4 and Chox-a JOURNAL Nucleic Acids Res 18 (7), 1739-1747 (1990) PUBMED 1970866 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000037.1. On Sep 23, 2021 this sequence version replaced NM_001030346.2. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combination :: X52670.1, SRR12888538.40123.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992432, SAMEA103992453 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-613 JAENSK010000037.1 1541354-1541966 c 614-1772 JAENSK010000037.1 1539702-1540860 c FEATURES Location/Qualifiers source 1..1772 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="2" /map="2" gene 1..1772 /gene="HOXA4" /gene_synonym="chox-1.4; HOX1.4" /note="homeobox A4" /db_xref="CGNC:49256" /db_xref="GeneID:395307" exon 1..613 /gene="HOXA4" /gene_synonym="chox-1.4; HOX1.4" /inference="alignment:Splign:2.1.0" CDS 16..945 /gene="HOXA4" /gene_synonym="chox-1.4; HOX1.4" /note="homeobox protein Hox-1.4" /codon_start=1 /product="homeobox protein Hox-A4" /protein_id="NP_001025517.1" /db_xref="CGNC:49256" /db_xref="GeneID:395307" /translation="
MTMSSFLINSNYIEPKFPPCEEYTQHSGSAGSSASYHPHHPHPHAPPPPPPPPPPHLHAAHPGPALPEYFPRPRREPGYQAPAAPPGPPGPPPEALYPAQAPSYPQAPYSYSSAGSAAPGPEQPPPGASPPPPPPAKGHPGPAQPLLPGHALQRRCEAAPAAGAGTGPGCALLPDKSLPGLKGKEPVVYPWMKKIHVSTVNPNYSGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKLPNTKMRSSNQPSLGQQQAKAQTQGHPRPLDGAAPNAAAL"
misc_feature 64..459 /gene="HOXA4" /gene_synonym="chox-1.4; HOX1.4" /note="propagated from UniProtKB/Swiss-Prot (P17277.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 577..594 /gene="HOXA4" /gene_synonym="chox-1.4; HOX1.4" /note="propagated from UniProtKB/Swiss-Prot (P17277.1); Region: Antp-type hexapeptide" misc_feature 643..813 /gene="HOXA4" /gene_synonym="chox-1.4; HOX1.4" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" misc_feature 814..942 /gene="HOXA4" /gene_synonym="chox-1.4; HOX1.4" /note="propagated from UniProtKB/Swiss-Prot (P17277.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" exon 614..1772 /gene="HOXA4" /gene_synonym="chox-1.4; HOX1.4" /inference="alignment:Splign:2.1.0" ORIGIN
gcacttcacaaattaatgaccatgagttcgtttttgataaactccaactacatcgagcccaaattccctccctgcgaggagtacacgcagcacagcggcagcgccggcagctccgccagctaccacccgcaccacccgcacccgcacgccccaccaccgccgccgccgccgccgccgccgcacctgcacgccgcgcacccgggccccgctctgcccgagtacttcccgcggccccgccgggaacccggctaccaggctcccgccgcgccgccggggccgccggggccgcctcccgaggcgctgtacccggcgcaggcaccctcctacccccaggctccctacagctacagcagcgccggcagcgccgccccgggccccgagcagccgcccccgggcgcctctccgccgccgccgccgccggccaagggccaccccgggccggcccagcccctgctccccggccatgccctgcagcgccgctgcgaagcggcccccgccgccggggccggcaccgggccgggctgcgcgttgctgcccgacaagagcctgcccgggctgaaggggaaggagccggtggtgtacccctggatgaagaagatccacgtgagcacggtcaaccccaactacagcggcggggagcccaagcggtcccgcaccgcctacacccgacagcaggtcctggagctggagaaggagttccacttcaaccgctacctgaccaggaggcgacgcatcgagatcgcgcacaccctgtgcctctccgagcgccaggtcaagatctggttccagaaccggcgcatgaagtggaagaaggaccacaagctgcccaacaccaagatgcgctcctccaaccagccctcgctcggccagcagcaggccaaggcacagacacagggccacccccgcccgctcgacggggctgcgcccaacgcggccgcgctataaggggctcgttgttcttgttttttttttttaatatatagatctctatttacctatctattggggttgtgcggccgcccgcgctggcggctggcccttgggaccacgcaactgtgtaagacaaagcaggagcagggaaggaaggacgagacgtgcccagggacgggcacacgttgaaaccaaaacccggacgattgcctacattgtatatagataatggttccatgcccgtcattttttttctatttatggaaaccctctcttgccctcgctgtaagagtgctggatgctgtcacggacgaattctccgtacctatgacggaccctttttttttgttgttgttgttgtcgttgtttttaaacagagaacactttacaaactaaaagacggttcaaacaaagccaggagctcggggggacgcccggtcgaggcggtgactcgagtggcgtgggccgagcgtggccgtgaggggcacacacggacccacgaggcacagagcggacacgttcacctcgggttaaaaactcatgggaagcgtcccctcacgccgtgttggtgtaccggccgtaacttagctgggtttcggtgtagccccgcagtagctgtgatatatgagtttttttcctccacattccccgtcgcatttatttaaaaagaaaagaataataataataacgctattaaaggctgtggctgttttcatatttggcaccgtctaaatcgtttgggtccatgtacaatttgtggattttttggtgtaatgtatacagtgccagatgctggtaataaagattattctgtacaaaaagaattaaacgcttgaaacaca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]