GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-15 16:46:52, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       XM_064984562            1158 bp    mRNA    linear   VRT 03-MAY-2024
DEFINITION  PREDICTED: Oncorhynchus masou masou putative proline-rich protein
            21 (LOC135552747), mRNA.
ACCESSION   XM_064984562
VERSION     XM_064984562.1
DBLINK      BioProject: PRJNA1103205
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Oncorhynchus masou masou (cherry salmon)
  ORGANISM  Oncorhynchus masou masou
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii;
            Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_088213) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_036934945.1-RS_2024_04
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 04/24/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1158
                     /organism="Oncorhynchus masou masou"
                     /mol_type="mRNA"
                     /isolate="Uvic2021"
                     /isolation_source="hatchery"
                     /sub_species="masou"
                     /db_xref="taxon:90313"
                     /chromosome="2"
                     /sex="pooled male and female"
                     /tissue_type="Heart, liver, sperm, and fin"
                     /dev_stage="Mature"
                     /geo_loc_name="Japan: Hokkaido"
                     /collection_date="2020-10-09"
                     /collected_by="Takafumi Fujimoto"
     gene            1..1158
                     /gene="LOC135552747"
                     /note="putative proline-rich protein 21; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:135552747"
     CDS             1..1158
                     /gene="LOC135552747"
                     /codon_start=1
                     /product="putative proline-rich protein 21"
                     /protein_id="XP_064840634.1"
                     /db_xref="GeneID:135552747"
                     /translation="
METQPCLMSSENKDMETQPCLMSSENKDMETQPCLMSSEIKDMETQPCLMSSENKDMETQPCLMSSENKDIETQPCLMSFENKDMETQPCLMSSEIKDMETQPCLMSSENKDMETQPCLMSSENKDMETQPCLMSSENMDMEKQPCLMSSENKDMETQPCLMSSENKDMETQPCLMSSEIKDMETQPCLMSSENKDMETQPCLMSSENKDMETQPCLMSSENKDMETQPCLMSSEIKDMETQPCLMSSENKDMEKQPCLMSSENKDMETQHCLMSSENKDMETQPCLMSSEIKDMETQPCLMSSENKDMETQPCFMSSENKDMETQPCLMSFENKDMETQPCLMSSENKDMETQPCLMSSENKDMETQPCLMTQPPRTWRHNPVS"
ORIGIN      
atggagacacaaccctgtctcatgagctctgaaaacaaggacatggagacacaaccctgtctcatgagctctgaaaacaaggacatggagacacaaccctgtctcatgagctctgaaatcaaggacatggagacacaaccctgtctcatgagctctgaaaacaaggacatggagacacaaccctgtctcatgagctctgaaaacaaggacatagagacacaaccctgtctcatgagctttgaaaacaaggacatggagacacaaccctgtctcatgagctctgaaatcaaggacatggagacacaaccctgtctcatgagctctgaaaacaaggacatggagacacaaccctgtctcatgagctctgaaaacaaggacatggagacacaaccctgtctcatgagctctgaaaacatggacatggagaaacaaccctgtctcatgagctctgaaaacaaggacatggagacacaaccctgtctcatgagctctgaaaacaaggacatggagacacaaccctgtctcatgagctctgaaatcaaggacatggagacacaaccctgtctcatgagctctgaaaacaaggacatggagacacaaccctgtctcatgagctctgaaaacaaggacatggagacacaaccctgtctcatgagctctgaaaacaaggacatggagacacaaccctgtctcatgagctctgaaatcaaggacatggagacacaaccctgtctcatgagctctgaaaacaaggacatggagaaacaaccctgtctcatgagctctgaaaacaaggacatggagacacaacactgtctcatgagctctgaaaacaaggacatggagacacaaccctgtctcatgagctctgaaatcaaggacatggagacacaaccctgtctcatgagctctgaaaacaaggacatggagacacaaccctgtttcatgagctctgaaaacaaggacatggagacacaaccctgtctcatgagctttgaaaacaaggacatggagacacaaccctgtctcatgagctctgaaaacaaggacatggagacacaaccctgtctcatgagctctgaaaacaaggacatggagacacaaccctgtctcatgacacaaccaccaaggacatggagacacaaccctgtctcatga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]