GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-15 19:34:38, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       XM_061956917             243 bp    mRNA    linear   VRT 26-DEC-2023
DEFINITION  PREDICTED: Nerophis lumbriciformis small VCP interacting protein
            (svip), mRNA.
ACCESSION   XM_061956917
VERSION     XM_061956917.1
DBLINK      BioProject: PRJNA1054156
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Nerophis lumbriciformis (worm pipefish)
  ORGANISM  Nerophis lumbriciformis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
            Acanthomorphata; Syngnathiaria; Syngnathiformes; Syngnathoidei;
            Syngnathidae; Nerophis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_026906091) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_033978685.1-RS_2023_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/19/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 6% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..243
                     /organism="Nerophis lumbriciformis"
                     /mol_type="mRNA"
                     /strain="RoL_2023-P1"
                     /db_xref="taxon:546530"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="Whole Body Except internal Organs"
                     /dev_stage="adult"
                     /geo_loc_name="Portugal"
                     /collection_date="2021-06-15"
     gene            1..243
                     /gene="svip"
                     /note="small VCP interacting protein; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:133603655"
     CDS             1..243
                     /gene="svip"
                     /codon_start=1
                     /product="small VCP/p97-interacting protein"
                     /protein_id="XP_061812901.1"
                     /db_xref="GeneID:133603655"
                     /translation="
MGMCLPCFGGAVDDAVDTPDPETRRRQLAEAAEKRQKETAHRGVKNPEAVERKRKKQEEIEKQTMSTSVSSGGGLRWQVG"
ORIGIN      
atggggatgtgcctaccgtgctttggtggggcagtcgacgacgctgttgacactccagatccagagacgaggaggcgacagttagccgaggctgcagaaaaaagacaaaaagagacagcacacaggggtgttaaaaacccagaagcggttgaaaggaaaagaaaaaagcaagaagagattgaaaaacagacgatgagtacatctgtgtctagtggtggcgggttgaggtggcaggtgggctga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]