2024-11-15 19:19:48, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS XM_058156240 456 bp mRNA linear VRT 17-JUL-2023 DEFINITION PREDICTED: Ahaetulla prasina mucin-2-like (LOC131184643), transcript variant X4, mRNA. ACCESSION XM_058156240 VERSION XM_058156240.1 DBLINK BioProject: PRJNA993715 KEYWORDS RefSeq. SOURCE Ahaetulla prasina ORGANISM Ahaetulla prasina Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Lepidosauria; Squamata; Bifurcata; Unidentata; Episquamata; Toxicofera; Serpentes; Colubroidea; Colubridae; Ahaetuliinae; Ahaetulla. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_080551) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_028640845.1-RS_2023_07 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 07/13/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..456 /organism="Ahaetulla prasina" /mol_type="mRNA" /isolate="Xishuangbanna" /db_xref="taxon:499056" /chromosome="13" /sex="female" /tissue_type="muscle" /dev_stage="adult" gene 1..456 /gene="LOC131184643" /note="mucin-2-like; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131184643" CDS 92..379 /gene="LOC131184643" /codon_start=1 /product="uncharacterized protein LOC131184643 isoform X4" /protein_id="XP_058012223.1" /db_xref="GeneID:131184643" /translation="
MAEGRGRPGGGSPVAGRRLLLLLLLPGALLSFLPQATPHPSVTHRYENVKAVEISVQPTAVEEVISGGKDAVEVQHQSKKKKNDIIELKETLEVF"
ORIGIN
cgcgggcggggcgcgggttccgaggcgggggcggcgggggcggcggttgtgcactcggccctgccgcccgaggaggaggcggaggcggcggatggcggaggggcgagggcggccgggtggcggctccccggtggcggggcggcggctgctgctgctgctgcttctcccaggggcgctgctgagcttcctcccgcaggcgaccccgcacccgagtgtgacacaccgttacgaaaatgttaaagcagtggagatatctgtgcagccaactgcagttgaagaggttatatcgggagggaaagatgctgttgaagtccagcatcaatctaaaaagaagaaaaatgacattatagagttgaaagagaccttggaggtcttctagtccaaatccctgctcaagcaggagatcctatccattctggacaaattactatccaatctcttcttgaaaagttccaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]