2024-11-15 19:34:02, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS XM_048275127 560 bp mRNA linear PLN 17-MAY-2022 DEFINITION PREDICTED: Rhodamnia argentea U-box domain-containing protein 7-like (LOC115752846), mRNA. ACCESSION XM_048275127 VERSION XM_048275127.1 DBLINK BioProject: PRJNA836871 KEYWORDS RefSeq. SOURCE Rhodamnia argentea ORGANISM Rhodamnia argentea Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Myrteae; Australasian group; Rhodamnia. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_063150) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Rhodamnia argentea Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..560 /organism="Rhodamnia argentea" /mol_type="mRNA" /isolate="NSW1041297" /db_xref="taxon:178133" /chromosome="1" /tissue_type="leaf" /dev_stage="Mature" /geo_loc_name="Australia: New South Wales" gene 1..560 /gene="LOC115752846" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:115752846" CDS 88..540 /gene="LOC115752846" /codon_start=1 /product="U-box domain-containing protein 7-like" /protein_id="XP_048131084.1" /db_xref="GeneID:115752846" /translation="
MIILAFTFFISHFSTSPCTFLHRSLLEAAVCSPCFFFLRNKELILAAGVVPLLQEMTSNHDSHPSATALYLNLSCLEDAKPVLGLSQAVPFLTQLLKDETAPQCKLDAIHALYNLSTYHDNIGYLPSAGIISGLQSLLADLVTKCGQKSQ"
ORIGIN
ttacttataacatgtttcaagagttgcttttttctttttgtataggagaaattaccatgctgttccttacatgctaaatggcacaacatgattattcttgccttcactttctttatctcccatttctccacctccccctgtactttcttgcatcgttctttgcttgaggcagcagtgtgttctccttgcttctttttcctcaggaacaaggagttgatattagctgccggagtcgttccgcttctccaggaaatgacatccaaccatgactctcatccatcagcaacggctctatatctgaatctttcctgccttgaagatgccaagcccgtactaggcttgagtcaggctgtaccctttcttacccagcttcttaaagatgaaactgcacctcagtgcaagcttgatgctattcacgccctttacaatctctccacctaccatgacaatattggatacctgccttcggcaggcattatcagtggccttcaatctcttcttgcagatctagtgaccaaatgtggacagaaaagtcaatagctgtccttatgaatttagat
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]