LOCUS       XM_045753933            1854 bp    mRNA    linear   INV 10-JAN-2022
DEFINITION  PREDICTED: Procambarus clarkii proline-rich extensin-like protein
            EPR1 (LOC123765388), mRNA.
ACCESSION   XM_045753933
VERSION     XM_045753933.1
DBLINK      BioProject: PRJNA793253
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Procambarus clarkii (red swamp crayfish)
  ORGANISM  Procambarus clarkii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea;
            Multicrustacea; Malacostraca; Eumalacostraca; Eucarida; Decapoda;
            Pleocyemata; Astacidea; Astacoidea; Cambaridae; Procambarus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_059613) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Procambarus clarkii Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1854
                     /organism="Procambarus clarkii"
                     /mol_type="mRNA"
                     /strain="Jiangsu"
                     /host="Homo sapiens"
                     /db_xref="taxon:6728"
                     /geo_loc_name="China:Nanjing, Hongze Lake"
                     /lat_lon="31.14 N 118.22 E"
                     /collection_date="2018-05-09"
                     /linkage_group="LG43"
     gene            1..1854
                     /gene="LOC123765388"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:123765388"
     CDS             1..1854
                     /gene="LOC123765388"
                     /codon_start=1
                     /product="proline-rich extensin-like protein EPR1"
                     /protein_id="XP_045609889.1"
                     /db_xref="GeneID:123765388"
                     /translation="

MFQLKLQVLNSSISYTSPCIDPPPVALTSPCIDPPPVALTSPCIDPPPVALTSPCIDPLPVALTSPCIDPPPVALTSPCIDPLPVALTSPCIDPPPVALTSPCIDPLPIALTSPCIDPLPVALTSPCIDPPPVALTSPCIDPPPVALTSPCIDPPPVALTSPCIVPPPVALTSPCIDPPPVALTSPCIDPPPVALTSPCIDPPPVAMTSPCIDPPPVALTSPCIDPLPVALTSPCIEPPPVALTSPCIDPPPVALTSPCIDPPPVALTSPCIDPPPVALTSPCIDPPPVALTSPCIDPPPVALTSPCIDPPPVALTSPCIDPPPVALTSPCIDPPLVALTSPCIDPPPVALTSPCIDPPPVALTSPCIDPPPVALTSPCIDPPPVALTSPCIDPPPVALTSPCIDPPPVALTSPCIDPLPVALTSPCIDPPTVALTSPCIDPPPVALTSPCIDPPPVALTSPCIDPPPVTLTSPCIDPPPVTLTSPCIDPPTVALTSPCIDPPTIALTSPCIDPLPVALTSPCIDPPTVALTSPCIDPPTVALTSPCIDPPTVALTSPCIDPPPVTLTSPCIDPPPVTLTSPCIDPPPVALTSPCIDPPPVALTSPCIDRPVALTFL"

     misc_feature    <133..1581
                     /gene="LOC123765388"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     misc_feature    1564..>1809
                     /gene="LOC123765388"
                     /note="Formin Homology Region 1; Region: Drf_FH1;
                     pfam06346"
                     /db_xref="CDD:461881"
ORIGIN      

atgtttcaattaaaattacaagttttgaattcaagtatttcttatacctctccgtgtattgaccctccacccgtagctctgacctctccatgtattgaccctccacctgtagcactgacctctccatgtattgaccctccacctgtagcactgacctctccatgtattgaccctctacctgtagctctgacctctccatgtattgaccctccacccgtagcattgacctctccatgtattgaccctctacctgtagctctgacctctccatgtattgaccctccacccgtagcattgacctctccatgtattgaccctctacctatagcattgacctctccatgtattgaccctctacctgtagctctgacctctccatgtattgaccctccacctgtagctctgacctctccatgtattgaccctccacctgtagctctgacctctccatgtattgaccctccacccgtagctctgacctctccatgtattgtccctccacccgtagctctgacctctccatgtattgaccctccacccgtagcactgacctctccatgtattgaccctccacctgtagctctgacctctccatgtattgaccctccacccgtagcaatgacctctccatgtattgaccctccacccgtagcactgacctctccatgtattgaccctctacctgtagctctgacctctccatgtattgagcctccacctgtagcactgacctctccatgtattgaccctccacctgtagctctgacctctccatgtattgaccctccacctgtagctctgacctctccatgtattgaccctccacccgtagcactgacctctccatgtattgaccctccacctgtagctctgacctctccatgtattgaccctccacccgtagcactgacctctccatgtattgaccctccacctgtagctctgacctctccatgtattgaccctccacctgtagcactgacctctccatgtattgaccctccactcgtagcactgacctctccatgtattgaccctccacccgtagcactgacctctccatgtattgaccctccacccgtagcactgacctctccatgtattgaccctccacccgtagcactgacctctccatgtattgaccctccacccgtagcactgacctctccatgtattgaccctccacccgtagcactgacctctccatgtattgaccctccacccgtagcactgacctctccatgtattgaccctctacccgtagcactgacctctccatgtattgaccctccaaccgtagcactgacctctccatgtattgaccctccacccgtagctctgacctctccatgtattgaccctccacccgtagctctgacctctccatgtattgaccctccacccgtaactctgacctctccatgtattgaccctccacccgtaactctgacctctccatgtattgaccctccaaccgtagctctgacctctccatgtattgaccctccaaccatagctctgacctctccatgtattgaccctctacccgtagcactgacctctccatgtattgaccctccaaccgtagctctgacctctccatgtattgaccctccaaccgtagctctgacctctccatgtattgaccctccaaccgtagctctgacctctccatgtattgaccctccacccgtaactctgacctctccatgtattgaccctccacccgtaactctgacctctccatgtattgaccctccacccgtagctctgacctctccatgtattgaccctccacccgtagcactgacctctccatgtattgaccgacccgtggcactgaccttcctgtaa

//