LOCUS       XM_045744451            3457 bp    mRNA    linear   INV 10-JAN-2022
DEFINITION  PREDICTED: Procambarus clarkii traB domain-containing protein-like
            (LOC123759413), transcript variant X5, mRNA.
ACCESSION   XM_045744451
VERSION     XM_045744451.1
DBLINK      BioProject: PRJNA793253
KEYWORDS    RefSeq.
SOURCE      Procambarus clarkii (red swamp crayfish)
  ORGANISM  Procambarus clarkii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea;
            Multicrustacea; Malacostraca; Eumalacostraca; Eucarida; Decapoda;
            Pleocyemata; Astacidea; Astacoidea; Cambaridae; Procambarus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_059593) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Procambarus clarkii Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..3457
                     /organism="Procambarus clarkii"
                     /mol_type="mRNA"
                     /strain="Jiangsu"
                     /host="Homo sapiens"
                     /db_xref="taxon:6728"
                     /geo_loc_name="China:Nanjing, Hongze Lake"
                     /lat_lon="31.14 N 118.22 E"
                     /collection_date="2018-05-09"
                     /linkage_group="LG23"
     gene            1..3457
                     /gene="LOC123759413"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 14 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:123759413"
     CDS             241..3291
                     /gene="LOC123759413"
                     /codon_start=1
                     /product="ribosome-binding protein 1-like isoform X2"
                     /protein_id="XP_045600407.1"
                     /db_xref="GeneID:123759413"
                     /translation="

MTSLGDFHNVSRAEVVTDVLNITEGEEALELASNDMSKSLDISQMSLESESMDSEVMDTAADSSRESALQSPDSAIGVTPTLTPEQEFQNTIPEKLSERPIQFIEDTQTSIQQLEESGGVGEIWYSPGTPVEIYSLPSTSFSSIVVENENVESNKRKEGHDVSRGSEGGHDVSRGSEGGHDVSRGSEGGHDVSRGSEGGHDVSRRSEGSHDVSRGSEGSHDVSRGSEGSHDVSRGSEGSHDVSRGSEGSHDVSRGSEGSHDVSRGSEGSHDVSRGSEGSHDVSRGSEGSHDVSRGSKGSHDVSRGSKGSHDLSWRSKGSHDLSRRSEGSHDVSRGSEGGHDVSRGSEGGHDVSRGSEGGHDVSRGSEGGHDVSRGSEGGHDVSRGSEGGHDVSRGSEGGHDVSRGSEGGHDESRRGEGGHDVSRGSEGSHDVSRGSEGSHDVSQGSEGSHDVSRGSKGRHDVSQGSEGSHDVSQGSEGSHDLSRGSKGSHDVSRGSEGSHDVSRGSKGSDDASRGSKGSHDVSRGSEGSHGVSRGSKGSHGVSRGSEGCHGVSRGSEGCHDVSRGSEGCHDVSRGSEGSHDVSRGSEGSHDVSRGSEGSHDVSRGSEGSHDVSRGSEGSHDVSRGSEGSHDVSRGSSEVSRGSSEVSQGSSEVSQGSSEVSQGSSEVSQGSSEVSQGSSEVSQGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGALRCPRGAPRCPRGAPRCPRGAPRCPRGAPRCPRGAPRCPRGAPRCPRGAPR"

     misc_feature    <856..>1767
                     /gene="LOC123759413"
                     /note="serine-rich protein; Region: ser_rich_anae_1;
                     NF033849"
                     /db_xref="CDD:468206"
     misc_feature    <1516..>2301
                     /gene="LOC123759413"
                     /note="serine-rich protein; Region: ser_rich_anae_1;
                     NF033849"
                     /db_xref="CDD:468206"
     misc_feature    <2308..>3285
                     /gene="LOC123759413"
                     /note="transcriptional regulator ICP4; Provisional;
                     Region: PHA03307"
                     /db_xref="CDD:223039"
     misc_feature    <3079..>3285
                     /gene="LOC123759413"
                     /note="ORF080 virion core protein; Provisional; Region:
                     PHA02682"
                     /db_xref="CDD:177464"
ORIGIN      

cacaatcagaactgtcagtttattgtacacgttacatgggatgaaatccgaccacaaaaacaaaacaaggacaatactgtacaaatactttagataatccgcgtaaattttgtgcgttaatccctatagccgggagccccgggactatcagtgtgttgttgagggccgcggtggatgggtcacgccccacgcttcttctcctttatcctccattctgctgcatgacaatttagtggctagatgacgtcattgggcgacttccacaatgtaagtcgggcagaggtggtgacagatgtcctgaatataacagagggcgaggaggcactagagttggctagcaatgacatgtcaaagtcacttgacatttcacaaatgtctttagaaagtgaatccatggatagtgaagtcatggatacagctgcagactcctccagggagtcggccctacagtcgccagactctgccattggtgtaacgcctaccttgacacctgaacaagagttccagaacactattcctgagaagctctctgaaaggcctatacaattcatagaagatacacaaacatcaatacagcagttagaagagagtggtggagttggagagatctggtattcgcctggaactccagtggaaatttatagtctaccatcaacgtccttttcatcaattgttgttgaaaatgagaatgtggaaagtaacaaaaggaaagaaggccatgatgtgtcccgggggagcgaaggcggccacgatgtgtcccgggggagcgaaggcggccacgatgtgtcccgggggagcgaaggcggccacgatgtgtcccgggggagcgaaggcggccacgatgtgtcccgaaggagcgaaggcagccacgatgtgtcccgagggagcgaaggcagccacgatgtgtcccgagggagcgaaggcagccacgatgtgtcccgagggagcgaaggcagccacgatgtgtcccgagggagcgaaggcagccacgatgtgtcccgagggagcgaaggcagccacgatgtgtcccgagggagcgaaggcagccacgatgtgtcccgagggagcgaaggcagccacgatgtgtcccgagggagcgaaggcagccacgatgtgtcccgggggagcaaaggcagccatgatgtgtcccgagggagcaaaggcagccacgatttgtcctggaggagcaaaggcagccacgatttgtcccggaggagcgaaggcagccacgatgtgtcccgggggagcgaaggcggccacgatgtgtcccgggggagcgaaggcggccacgatgtgtcccgggggagcgaaggcggccacgatgtgtcccgggggagcgaaggcggccacgatgtgtcccgagggagcgaaggcggccacgatgtgtctcgggggagcgaaggcggccacgatgtgtcccgagggagcgaaggcggccacgatgtgtcccgggggagcgaaggcggccacgatgagtcccgaaggggcgaaggcggccacgatgtgtcccgggggagcgaaggcagccacgatgtgtcccgagggagcgaaggcagccacgatgtgtcccaagggagcgaaggcagccacgatgtgtcccgagggagcaaaggcaggcacgatgtgtcccaagggagcgaaggcagccacgatgtgtcccaagggagcgaaggcagccacgatttgtcccgggggagcaaaggcagccacgatgtgtcccgagggagcgaaggcagccacgatgtgtcccgagggagcaaaggcagcgacgatgcgtcccgagggagcaaaggcagccacgatgtgtcccgagggagcgaaggcagccacggtgtgtcccgggggagcaaaggcagccacggtgtgtcccgggggagcgaaggctgccacggtgtgtcccgggggagcgaaggctgccacgatgtgtcccgggggagcgaaggctgccacgatgtgtcccgagggagcgaaggcagccacgatgtgtcccgagggagcgaaggcagccacgatgtgtcccgggggagcgaaggcagccacgatgtgtcccgggggagcgaaggcagccacgatgtgtcccgggggagcgaaggcagccacgatgtgtcccgggggagcgaaggcagccacgatgtgtcccgggggagctctgaggtgtcccgggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccagggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctctgaggtgtcccaggggagctccgaggtgtcccaggggagctccgaggtgtcccaggggagctccgaggtgtcccaggggagctccgaggtgtcccaggggagctccgaggtgtcccaggggagctccgaggtgtcccaggggagctccgaggtaaagcaacaccaaattagtgtggataaaatggaagttgacaatattgcaaggttatccacttcgctaagtcggttacggataagctatattccaccattaattactctctctcgagaagttgtagaaaatttcagcgttgctcagatgacgagcatgacccaagaaat

//