LOCUS       XM_039103003             853 bp    mRNA    linear   ROD 22-FEB-2024
DEFINITION  PREDICTED: Rattus norvegicus glutathione S-transferase mu 3
            (Gstm3), transcript variant X2, mRNA.
ACCESSION   XM_039103003
VERSION     XM_039103003.2
DBLINK      BioProject: PRJNA1074393
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_086020) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Feb 22, 2024 this sequence version replaced XM_039103003.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_036323735.1-RS_2024_02
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 02/09/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..853
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN/NHsdMcwi"
                     /bio_material="RGD 61498"
                     /db_xref="taxon:10116"
                     /chromosome="2"
                     /sex="male"
                     /tissue_type="kidney, spleen, liver"
                     /geo_loc_name="USA: Wisconsin, Milwaukee"
                     /lat_lon="43.05 N 88.04 W"
                     /collected_by="Rebecca Schilling, Melinda Dwinell"
     gene            1..853
                     /gene="Gstm3"
                     /gene_synonym="Gstm3l; Gstm3l1; Gstm4; GstYb4"
                     /note="glutathione S-transferase mu 3; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 EST, 2 long SRA reads, 1 Protein"
                     /db_xref="GeneID:57298"
                     /db_xref="RGD:620381"
     CDS             96..428
                     /gene="Gstm3"
                     /gene_synonym="Gstm3l; Gstm3l1; Gstm4; GstYb4"
                     /codon_start=1
                     /product="glutathione S-transferase Mu 3 isoform X1"
                     /protein_id="XP_038958931.1"
                     /db_xref="GeneID:57298"
                     /db_xref="RGD:620381"
                     /translation="

MAMILGYWNVRGEKQKPEFLKSIPEKMKIYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPECLDAFPNLKDFLARFEGLKKISAYMKSSSFLPRPVFTKIAQWGTD"

     misc_feature    <132..407
                     /gene="Gstm3"
                     /gene_synonym="Gstm3l; Gstm3l1; Gstm4; GstYb4"
                     /note="C-terminal, alpha helical domain of the Glutathione
                     S-transferase family; Region: GST_C_family; cl02776"
                     /db_xref="CDD:470672"
     polyA_site      853
                     /gene="Gstm3"
                     /gene_synonym="Gstm3l; Gstm3l1; Gstm4; GstYb4"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      

tgcagggccccacccacctttcccttagtgcctctttataattccccagctcaacttgtctgaagccagtctgagaagaccacagcaccagagccatggctatgatactgggatattggaacgttcgcggagagaagcagaagccagagttcttgaagtccatcccggagaagatgaaaatctattcagagttcctgggcaagcgaccatggtttgcaggggacaaggtcacctatgtggatttccttgcttatgacattcttgaccagtaccgtatgtttgagcccgagtgcctggacgccttcccaaacctgaaggacttcctggcccgcttcgagggcctgaagaagatctctgcttacatgaagagtagcagctttctcccaagacctgtgtttactaagatagcccagtggggcactgattaggcccctgccatgctggcactcacaggaaggacctgtccacactggatcctgcaggccctgggcaggaacagcacttttgcactgtggctcctggttctctctccttccctatcccttctccagctttctcagcctcatctcctcgccctcaccccagtcaagtccacacagtcctcattcttcccactttctttcattatgatccccttcttcttatggcaccctaacccatcctcacagaccttttctgtgatttgaggtctgccctgaactcaggctccctagaattaacccaaaggtcaatgctgtctcagtgccagccctccttagaattaccccgaagctcaacactgtctcagtgccagcctgttctcctggaggagcttccctcagcctgtctcatctctaataaagcctgaaacaca

//