GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-15 19:58:20, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       XM_029430413            1684 bp    mRNA    linear   VRT 06-JUN-2019
DEFINITION  PREDICTED: Cottoperca gobio putative leucine-rich repeat-containing
            protein DDB_G0290503 (LOC115007503), mRNA.
ACCESSION   XM_029430413
VERSION     XM_029430413.1
DBLINK      BioProject: PRJNA530544
KEYWORDS    RefSeq; corrected model; includes ab initio.
SOURCE      Cottoperca gobio
  ORGANISM  Cottoperca gobio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
            Acanthomorphata; Eupercaria; Perciformes; Notothenioidei;
            Bovichtidae; Cottoperca.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_041355.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Cottoperca gobio Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio            :: 4% of CDS bases
            internal stop codons :: corrected 1 genomic stop codon
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1684
                     /organism="Cottoperca gobio"
                     /mol_type="mRNA"
                     /db_xref="taxon:56716"
                     /chromosome="1"
     gene            1..1684
                     /gene="LOC115007503"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 91% coverage of the
                     annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:115007503"
     CDS             1..1359
                     /gene="LOC115007503"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: substituted 1 base at 1
                     genomic stop codon"
                     /codon_start=1
                     /transl_except=(pos:814..816,aa:OTHER)
                     /product="LOW QUALITY PROTEIN: putative leucine-rich
                     repeat-containing protein DDB_G0290503"
                     /protein_id="XP_029286273.1"
                     /db_xref="GeneID:115007503"
                     /translation="
MIQMREVTKSNSERETNIILLHSSYNNLTEEKDELQTRHNNLTKEKDELQTKYNNLTKEKDQLQTRHNNLTEEKDQLQTRHNNLTEEKDELQTRHNNLTEEKDELQTRHNNLTEEKDELQTRYNNLTEEKDELQTRYNNLTKEKDELQTRYNNLTEEKDELQTRYNNLTKEKDQLQTRYNNLTKEKDQLQTRYNNLTEEKDELQTRYNNLTKEKDQLQTRYNNLTKEKDQLQTSYNNLTKEKDQLQTRYNNLTEEKDELQTSYNNLTKEKDXLQTRYNNLTKEKDQLQTRYNNLTKEKDQLQTRYNNLTKEKDQLQTRYNNLTKEKDQLQTSYNNLTKEKDQLQTSYNNLTEEKDQLQTRYNNLTEEKDQLQTSYNNLTEEKDQLQTRYNNLTEEKDQLQTSYNNLTEEKDQLQTRYNNLTEEKDKLQERFEALTKDINDLQRERGCYIPGK"
     misc_feature    <19..1140
                     /gene="LOC115007503"
                     /note="chromosome segregation protein SMC, common
                     bacterial type; Region: SMC_prok_B; TIGR02168"
                     /db_xref="CDD:274008"
     misc_feature    1105..>1329
                     /gene="LOC115007503"
                     /note="Protein of unknown function (DUF3450); Region:
                     DUF3450; pfam11932"
                     /db_xref="CDD:432198"
ORIGIN      
atgattcagatgagggaagtcaccaagagcaactctgagagggaaacaaacattatcctgttacacagcagttacaacaacctgactgaagagaaagacgagttacagaccagacacaacaacctgactaaagagaaagacgagttacagaccaaatacaacaacctgactaaagagaaagaccagttacagaccagacacaacaacctgactgaagagaaagaccagttacagaccagacacaacaacctgactgaagagaaagacgagttacagaccagacacaacaacctgactgaagagaaagacgagttacagaccagacacaacaacctgactgaagagaaagacgagttacagaccagatacaacaacctgactgaagagaaagacgagttacagaccagatacaacaacctgactaaagagaaagacgagttacagaccagatacaacaacctgactgaagagaaagacgagttacagaccagatacaacaacctgactaaagagaaagaccagttacagaccagatacaacaacctgaccaaagagaaagaccagttacagaccagatacaacaacctgactgaagagaaagacgagttacagaccagatacaacaacctgactaaagagaaagaccagttacagaccagatacaacaacctgactaaagagaaagaccagttacagaccagttacaacaacctgactaaagagaaagaccagttacagacccgttacaacaacctgactgaagagaaagacgagttacagaccagttacaacaacctgactaaagagaaagactagttacagaccagatacaacaacctgactaaagagaaagaccagttacagaccagatacaacaacctgactaaagagaaagaccagttacagaccagatacaacaacctgactaaagagaaagaccagttacagaccagatacaacaacctgactaaagagaaagaccagttacagaccagttacaacaacctgactaaagagaaagaccagttacagaccagttacaacaacctgactgaagagaaagaccagttacagaccagatacaacaacctgactgaagagaaagaccagttacagaccagttacaacaacctgactgaagagaaagaccagttacagaccagatacaacaacctgactgaagagaaagaccagttacagaccagttacaacaacctgactgaagagaaagaccagttacagaccagatacaacaacctgactgaagagaaagacaagctgcaagagagatttgaagccctgaccaaagacataaatgatcttcagagagagagaggttgttatatcccaggaaaatgaaggctcgatttactgcacacaaaggaagaggatcgcgcttgagttgtacctatctttcacaatgaaggctgtagacatatacactgcatcattgcttaccagagagcattttgcaaagaggcgactcaacaaaaaagcttaactcaggatccctggcttcctgtccatccgcctgcctgctacctgctacccacttcaccctctgcctccacaagcaggatgttctctgtcctccgaaccctttccctggaaaccccttaaatatacctcctatctattgtattattaagtaatacttccctgcttttggtgtgtgatttatcta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]