LOCUS       XM_029032793             300 bp    mRNA    linear   PLN 29-MAR-2023
DEFINITION  [Candida] auris 60S_ribosomal_protein_L36 (CJI96_0003372), partial
            mRNA.
ACCESSION   XM_029032793
VERSION     XM_029032793.1
DBLINK      BioProject: PRJNA535510
            BioSample: SAMN05379608
KEYWORDS    RefSeq.
SOURCE      Candidozyma auris (Candida auris)
  ORGANISM  Candidozyma auris
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Metschnikowiaceae; Candidozyma.
REFERENCE   1  (bases 1 to 300)
  AUTHORS   Munoz,J.F., Gade,L., Chow,N.A., Loparev,V.N., Juieng,P.,
            Berkow,E.L., Farrer,R.A., Litvintseva,A.P. and Cuomo,C.A.
  TITLE     Genomic insights into multidrug-resistance, mating and virulence in
            Candida auris and related emerging species
  JOURNAL   Nat Commun 9 (1), 5346 (2018)
   PUBMED   30559369
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 300)
  AUTHORS   Munoz,J.F., Welsh,R.M., Shea,T.S., Batra,D.B., Litvintseva,A.P.,
            Gade,L.G. and Cuomo,C.A.
  TITLE     Candida auris genome assembly and annotation
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 300)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (29-MAR-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 300)
  AUTHORS   Munoz,J.F., Welsh,R.M., Shea,T.S., Batra,D.B., Litvintseva,A.P.,
            Gade,L.G. and Cuomo,C.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-AUG-2019) Genome Sequencing and Analysis Program,
            Broad Institute of MIT and Harvard, 415 Main Street, Cambridge, MA
            02142, USA
REFERENCE   5  (bases 1 to 300)
  AUTHORS   Munoz,J.F., Gade,L.G., Chow,N.A., Litvintseva,A.P., Loparev,V.N.
            and Cuomo,C.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-MAR-2018) Genome Sequencing and Analysis Program,
            Broad Institute of MIT and Harvard, 415 Main Street, Cambridge, MA
            02142, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_072814).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..300
                     /organism="Candidozyma auris"
                     /mol_type="mRNA"
                     /strain="B11220"
                     /isolation_source="auditory canal"
                     /host="Homo sapiens"
                     /type_material="culture from holotype of Candida auris
                     Satoh & Makimura, 2009"
                     /db_xref="taxon:498019"
                     /chromosome="3"
                     /geo_loc_name="Japan"
                     /collection_date="2009"
     gene            <1..>300
                     /locus_tag="CJI96_0003372"
                     /old_locus_tag="CJI97_000728"
                     /db_xref="GeneID:40025875"
     CDS             1..300
                     /locus_tag="CJI96_0003372"
                     /old_locus_tag="CJI97_000728"
                     /codon_start=1
                     /transl_table=12
                     /product="60S_ribosomal_protein_L36"
                     /protein_id="XP_028893108.1"
                     /db_xref="GeneID:40025875"
                     /translation="

MARSGIAVGLNKGHKVNAKEVAPKISQRKGALSQRTKFVRSIVSEVSGLAPYERRLIELIRNAGEKRAKKLAKKRLGTHKRALRKVEEMNQIIAESRRH"

     misc_feature    7..294
                     /locus_tag="CJI96_0003372"
                     /old_locus_tag="CJI97_000728"
                     /note="Ribosomal protein L36e; Region: Ribosomal_L36e;
                     pfam01158"
                     /db_xref="CDD:460088"
ORIGIN      

atggctagatctggtattgctgtcggtttgaacaagggccacaaggtcaacgctaaggaggttgctccaaagatctcccagagaaagggcgccctttcccagagaaccaagttcgtcagaagcattgtgtctgaggtttccggcttggctccatacgagagaagattgatcgagttgatcagaaacgccggtgagaagagagccaagaagttggccaagaagagattgggtactcacaagagagctctcagaaaggttgaggagatgaaccagatcattgctgagtccagaagacactaa

//