2024-11-15 16:24:11, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS XM_027354157 978 bp mRNA linear INV 14-DEC-2018 DEFINITION PREDICTED: Penaeus vannamei myb-like protein I (LOC113803375), mRNA. ACCESSION XM_027354157 VERSION XM_027354157.1 DBLINK BioProject: PRJNA508983 KEYWORDS RefSeq; includes ab initio. SOURCE Penaeus vannamei (Pacific white shrimp) ORGANISM Penaeus vannamei Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea; Multicrustacea; Malacostraca; Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea; Penaeidae; Penaeus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_020868345.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Penaeus vannamei Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..978 /organism="Penaeus vannamei" /mol_type="mRNA" /isolation_source="sea water" /db_xref="taxon:6689" /chromosome="Unknown" /sex="male" /tissue_type="muscle" /dev_stage="adult" /geo_loc_name="China: Hainan" /lat_lon="18.75 N 108.70 E" /altitude="-3 m" /collection_date="2014-03" /collected_by="Xiaojun Zhang" /breed="Kehai No.1" gene 1..978 /gene="LOC113803375" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:113803375" CDS 1..978 /gene="LOC113803375" /codon_start=1 /product="myb-like protein I" /protein_id="XP_027209958.1" /db_xref="GeneID:113803375" /translation="
MRKMASNAFRTPDNTTALTTALNRQNSSQNKRLTHSVLTTALHSSNNGSDNSSNNSSANLTILNNSSANATILTTALQRLYSVNGSTNNSNNSSANSSNNSSVNSSNNSSINNSNNSSANSSNNSANGSTNNSNNSSANGSSNGSANSSNNSSVNSSINNSNNSSANGSTLNSSNNSSINNSNNSSATLTSSNNSSANALPNNSTTALPTILTTALPTALTTALTTALTTVLPTALTSSNNSSANGSANSSNNSSANSSNNGSANSSNNSSANGSDNSSNNTHTQRTTITTFQPHNHILYNPYNRIPCNLQPYNTTLLKSQTYPL"
ORIGIN
atgcggaaaatggcttccaacgcgttcagaacaccagacaacacaacagctctaacaacagctctcaacagacaaaacagctctcaaaacaaacggctaacacactctgttctaacaacagctctccacagctctaacaacggctctgacaacagctctaacaacagttctgccaatctaacaattctaaacaacagctctgccaacgcaacaattctaacaacagctctgcaacggctctactctgtcaacggctctaccaacaattctaacaacagctctgccaacagttctaacaacagctctgtcaacagctctaacaacagctctatcaacaattctaacaacagctctgccaacagctctaacaactctgccaacggctctaccaacaattctaacaacagctctgccaacggctctagcaacggctctgccaacagctctaacaacagctctgtcaacagctctatcaacaattctaacaacagctctgccaacggctctactctgaacagctctaacaacagctctatcaacaattctaacaacagctctgcaacactaacaagttctaacaacagctctgccaacgctctaccaaacaattcaacaacagctctgccaacaattctaacaacagctctgccaacagctctaacaacggctctgacaacagctctaacaacagttctgccaacggctctaacaagttctaacaacagctctgccaacggctctgccaacagctctaacaacagctctgccaacagctctaacaacggctctgccaacagctctaacaacagctctgccaacggctctgacaacagctctaacaacacccatacacaacgaaccactattacaaccttccagccacataaccatatcctttacaacccctacaaccgtatcccttgcaacctacaaccttacaatacaacccttctaaaatcacaaacctatcccttataa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]