GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-15 16:24:11, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       XM_027354157             978 bp    mRNA    linear   INV 14-DEC-2018
DEFINITION  PREDICTED: Penaeus vannamei myb-like protein I (LOC113803375),
            mRNA.
ACCESSION   XM_027354157
VERSION     XM_027354157.1
DBLINK      BioProject: PRJNA508983
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Penaeus vannamei (Pacific white shrimp)
  ORGANISM  Penaeus vannamei
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea;
            Multicrustacea; Malacostraca; Eumalacostraca; Eucarida; Decapoda;
            Dendrobranchiata; Penaeoidea; Penaeidae; Penaeus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_020868345.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Penaeus vannamei Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..978
                     /organism="Penaeus vannamei"
                     /mol_type="mRNA"
                     /isolation_source="sea water"
                     /db_xref="taxon:6689"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="muscle"
                     /dev_stage="adult"
                     /geo_loc_name="China: Hainan"
                     /lat_lon="18.75 N 108.70 E"
                     /altitude="-3 m"
                     /collection_date="2014-03"
                     /collected_by="Xiaojun Zhang"
                     /breed="Kehai No.1"
     gene            1..978
                     /gene="LOC113803375"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins"
                     /db_xref="GeneID:113803375"
     CDS             1..978
                     /gene="LOC113803375"
                     /codon_start=1
                     /product="myb-like protein I"
                     /protein_id="XP_027209958.1"
                     /db_xref="GeneID:113803375"
                     /translation="
MRKMASNAFRTPDNTTALTTALNRQNSSQNKRLTHSVLTTALHSSNNGSDNSSNNSSANLTILNNSSANATILTTALQRLYSVNGSTNNSNNSSANSSNNSSVNSSNNSSINNSNNSSANSSNNSANGSTNNSNNSSANGSSNGSANSSNNSSVNSSINNSNNSSANGSTLNSSNNSSINNSNNSSATLTSSNNSSANALPNNSTTALPTILTTALPTALTTALTTALTTVLPTALTSSNNSSANGSANSSNNSSANSSNNGSANSSNNSSANGSDNSSNNTHTQRTTITTFQPHNHILYNPYNRIPCNLQPYNTTLLKSQTYPL"
ORIGIN      
atgcggaaaatggcttccaacgcgttcagaacaccagacaacacaacagctctaacaacagctctcaacagacaaaacagctctcaaaacaaacggctaacacactctgttctaacaacagctctccacagctctaacaacggctctgacaacagctctaacaacagttctgccaatctaacaattctaaacaacagctctgccaacgcaacaattctaacaacagctctgcaacggctctactctgtcaacggctctaccaacaattctaacaacagctctgccaacagttctaacaacagctctgtcaacagctctaacaacagctctatcaacaattctaacaacagctctgccaacagctctaacaactctgccaacggctctaccaacaattctaacaacagctctgccaacggctctagcaacggctctgccaacagctctaacaacagctctgtcaacagctctatcaacaattctaacaacagctctgccaacggctctactctgaacagctctaacaacagctctatcaacaattctaacaacagctctgcaacactaacaagttctaacaacagctctgccaacgctctaccaaacaattcaacaacagctctgccaacaattctaacaacagctctgccaacagctctaacaacggctctgacaacagctctaacaacagttctgccaacggctctaacaagttctaacaacagctctgccaacggctctgccaacagctctaacaacagctctgccaacagctctaacaacggctctgccaacagctctaacaacagctctgccaacggctctgacaacagctctaacaacacccatacacaacgaaccactattacaaccttccagccacataaccatatcctttacaacccctacaaccgtatcccttgcaacctacaaccttacaatacaacccttctaaaatcacaaacctatcccttataa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]