2024-11-15 19:24:59, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS XM_021033133 391 bp mRNA linear PLN 11-MAY-2017 DEFINITION PREDICTED: Arabidopsis lyrata subsp. lyrata ubiquitin-conjugating enzyme E2 36-like (LOC110230388), mRNA. ACCESSION XM_021033133 VERSION XM_021033133.1 DBLINK BioProject: PRJNA49545 KEYWORDS RefSeq. SOURCE Arabidopsis lyrata subsp. lyrata ORGANISM Arabidopsis lyrata subsp. lyrata Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_003302553.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Arabidopsis lyrata subsp. lyrata Annotation Release 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..391 /organism="Arabidopsis lyrata subsp. lyrata" /mol_type="mRNA" /sub_species="lyrata" /bio_material="NASC:donor number MN47" /db_xref="taxon:81972" /chromosome="Unknown" gene 1..391 /gene="LOC110230388" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 12 samples with support for all annotated introns" /db_xref="GeneID:110230388" CDS 34..267 /gene="LOC110230388" /codon_start=1 /product="ubiquitin-conjugating enzyme E2 36-like" /protein_id="XP_020888792.1" /db_xref="GeneID:110230388" /translation="
MSSMVMKMMGMFHMYLLVTELWRICGILSLQRWLKERDFHINSSRYFNVMILGPTQSPYEGVGFESRSKYLFGKVSI"
misc_feature 151..>216 /gene="LOC110230388" /note="Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain/ubiquitin E2 variant (UEV) domain; Region: UBCc_UEV; cl49610" /db_xref="CDD:483950" ORIGIN
gtgattttagacattgggaaatggtggaatcatatgagcagcatggtgatgaaaatgatgggcatgttccatatgtaccttctggtgacagaattatggaggatatgcgggattctatcactacagagatggctgaaggaacgagacttccatattaacagctcccggtatttcaatgttatgattcttggacctacacaatcaccttatgaaggagttgggtttgaatcgagaagcaaatacttgtttggtaaagtctctatctagattaagcaaatcgaggaacaaaaccaatctcttcttgctctgttttaagacactgctttgattattatgtccctaatcttacattatgaatgtatttcactaaagcagtgacattggttggttt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]