GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-15 19:50:41, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       XM_020573799             198 bp    mRNA    linear   INV 17-MAR-2017
DEFINITION  Polysphondylium pallidum PN500 40S ribosomal protein S30 (rps30-2),
            partial mRNA.
ACCESSION   XM_020573799
VERSION     XM_020573799.1
DBLINK      BioProject: PRJNA46447
            BioSample: SAMN02953767
KEYWORDS    RefSeq.
SOURCE      Heterostelium album PN500
  ORGANISM  Heterostelium album PN500
            Eukaryota; Amoebozoa; Evosea; Eumycetozoa; Dictyostelia;
            Acytosteliales; Acytosteliaceae; Heterostelium.
REFERENCE   1  (bases 1 to 198)
  AUTHORS   Gloeckner,G., Schaap,P., Noegel,A.A., Felder,M., Eichinger,L.,
            Heidel,A.J. and Platzer,M.
  TITLE     Living fossils from the dawn of multicellularity
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 198)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAR-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 198)
  AUTHORS   Gloeckner,G., Schaap,P., Noegel,A.A., Felder,M. and Platzer,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-DEC-2009) Genome Analysis, Fritz Lipmann Institute,
            Beutenbergstr. 11, Jena 07745, Germany
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_008805065).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..198
                     /organism="Heterostelium album PN500"
                     /mol_type="mRNA"
                     /strain="PN500"
                     /db_xref="taxon:670386"
                     /chromosome="Unknown"
     gene            <1..>198
                     /gene="rps30-2"
                     /locus_tag="PPL_02821"
                     /db_xref="GeneID:31358344"
     CDS             1..198
                     /gene="rps30-2"
                     /locus_tag="PPL_02821"
                     /codon_start=1
                     /product="40S ribosomal protein S30"
                     /protein_id="XP_020435871.1"
                     /db_xref="GeneID:31358344"
                     /translation="
MGKVHGGLNRAGKVRNATPNVEKKEVRKPKVGRAKKRLLYNRRFVNVVVGFGKKKGYNTQNVPNV"
     misc_feature    7..180
                     /gene="rps30-2"
                     /locus_tag="PPL_02821"
                     /note="Ribosomal protein S30; Region: Ribosomal_S30;
                     pfam04758"
                     /db_xref="CDD:398432"
ORIGIN      
atgggtaaggttcacggtggtttgaacagagctggtaaagtcagaaacgctactccaaacgttgagaagaaggaggtcagaaagccaaaggttggtcgtgccaagaagagattgttgtacaaccgtcgtttcgtcaacgttgtcgttggtttcggaaagaagaagggttacaacactcaaaacgtcccaaatgtctaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]