2024-11-15 19:50:41, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS XM_020573799 198 bp mRNA linear INV 17-MAR-2017 DEFINITION Polysphondylium pallidum PN500 40S ribosomal protein S30 (rps30-2), partial mRNA. ACCESSION XM_020573799 VERSION XM_020573799.1 DBLINK BioProject: PRJNA46447 BioSample: SAMN02953767 KEYWORDS RefSeq. SOURCE Heterostelium album PN500 ORGANISM Heterostelium album PN500 Eukaryota; Amoebozoa; Evosea; Eumycetozoa; Dictyostelia; Acytosteliales; Acytosteliaceae; Heterostelium. REFERENCE 1 (bases 1 to 198) AUTHORS Gloeckner,G., Schaap,P., Noegel,A.A., Felder,M., Eichinger,L., Heidel,A.J. and Platzer,M. TITLE Living fossils from the dawn of multicellularity JOURNAL Unpublished REFERENCE 2 (bases 1 to 198) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (17-MAR-2017) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 198) AUTHORS Gloeckner,G., Schaap,P., Noegel,A.A., Felder,M. and Platzer,M. TITLE Direct Submission JOURNAL Submitted (11-DEC-2009) Genome Analysis, Fritz Lipmann Institute, Beutenbergstr. 11, Jena 07745, Germany COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_008805065). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..198 /organism="Heterostelium album PN500" /mol_type="mRNA" /strain="PN500" /db_xref="taxon:670386" /chromosome="Unknown" gene <1..>198 /gene="rps30-2" /locus_tag="PPL_02821" /db_xref="GeneID:31358344" CDS 1..198 /gene="rps30-2" /locus_tag="PPL_02821" /codon_start=1 /product="40S ribosomal protein S30" /protein_id="XP_020435871.1" /db_xref="GeneID:31358344" /translation="
MGKVHGGLNRAGKVRNATPNVEKKEVRKPKVGRAKKRLLYNRRFVNVVVGFGKKKGYNTQNVPNV"
misc_feature 7..180 /gene="rps30-2" /locus_tag="PPL_02821" /note="Ribosomal protein S30; Region: Ribosomal_S30; pfam04758" /db_xref="CDD:398432" ORIGIN
atgggtaaggttcacggtggtttgaacagagctggtaaagtcagaaacgctactccaaacgttgagaagaaggaggtcagaaagccaaaggttggtcgtgccaagaagagattgttgtacaaccgtcgtttcgtcaacgttgtcgttggtttcggaaagaagaagggttacaacactcaaaacgtcccaaatgtctaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]