LOCUS       XM_015032183             707 bp    mRNA    linear   VRT 15-DEC-2015
DEFINITION  PREDICTED: Poecilia latipinna Fc fragment of IgE, high affinity I,
            receptor for; gamma polypeptide (fcer1g), mRNA.
ACCESSION   XM_015032183
VERSION     XM_015032183.1
DBLINK      BioProject: PRJNA305623
KEYWORDS    RefSeq.
SOURCE      Poecilia latipinna (sailfin molly)
  ORGANISM  Poecilia latipinna
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
            Acanthomorphata; Ovalentaria; Atherinomorphae; Cyprinodontiformes;
            Poeciliidae; Poeciliinae; Poecilia.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_015112630.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Poecilia latipinna Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..707
                     /organism="Poecilia latipinna"
                     /mol_type="mRNA"
                     /isolate="Pla-1442-1.1"
                     /db_xref="taxon:48699"
                     /chromosome="Unknown"
                     /sex="female"
                     /dev_stage="adult"
     gene            1..707
                     /gene="fcer1g"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 9 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 74 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:106947285"
     CDS             148..432
                     /gene="fcer1g"
                     /codon_start=1
                     /product="high affinity immunoglobulin epsilon receptor
                     subunit gamma"
                     /protein_id="XP_014887669.1"
                     /db_xref="GeneID:106947285"
                     /translation="

MGARAGSRLLAAVPLWMCFGRAAALSEPEICYVLDGILFLYGIILTALYCRVKIYNAREASGGKGKSKQNVEEGIYTGLTPHKQDTYETIGMKK"

     misc_feature    226..309
                     /gene="fcer1g"
                     /note="T-cell surface glycoprotein CD3 zeta chain; Region:
                     TCR_zetazeta; pfam11628"
                     /db_xref="CDD:463313"
ORIGIN      

tcgagctcagaccacaacttcccctcgtagctgtgaggtacgcaacacccgagtgccgagacagacagaggaaagcatcgcccagcgtctgctgttgctgctgctgctgctccagttcgtgtttcagccacgtttcagcccgtcaccatgggagcgagggccgggagtcggttgctggccgccgtccctctctggatgtgtttcggcagagccgctgctctctcggagccagagatctgctacgttctggatgggattcttttcctgtacggcatcatcctgaccgcgctctactgcagggtcaagatctacaacgccagagaggccagcggcggaaaaggaaagtcaaagcagaatgtggaagagggcatctacacgggtctgactcctcacaagcaggacacatacgaaaccatcggcatgaagaagtgatctcagccggccacagcgttctgtcttgttttttttttttcttttgtatttaaacataacacatctcacactctgtttttttatgccaacgctcgtttccccattttgcttttgttgaatcgagcagaagttgaggaggaagagatagaaaagaagaagtgatgcggcttgctgtttgagatactcttcctgtcctcttggacatatttaacattttattttgactactgatatcctgaagatgcatttaaacgcttaagtgtgaaaaaaaaaaa

//