2024-11-15 19:24:06, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS XM_012897535 297 bp mRNA linear INV 15-JUN-2015 DEFINITION Acytostelium subglobosum LB1 hypothetical protein partial mRNA. ACCESSION XM_012897535 VERSION XM_012897535.1 DBLINK BioProject: PRJNA280978 BioSample: SAMD00019534 KEYWORDS RefSeq. SOURCE Acytostelium subglobosum LB1 ORGANISM Acytostelium subglobosum LB1 Eukaryota; Amoebozoa; Evosea; Eumycetozoa; Dictyostelia; Acytosteliales; Acytosteliaceae; Acytostelium. REFERENCE 1 AUTHORS Urushihara,H., Kuwayama,H., Fukuhara,K., Ithoh,T., Kagoshima,H., Shin-I,T., Ohishi,K., Taniguchi,T., Noguchi,H., Kuroki,Y., Hata,T., Uchi,K., Mohri,K., Kohara,Y. and Fujiyama,Y. TITLE Comparative genome and transcriptome analyses of the social amoeba Acytostelium subglobosum that accomplishes multicellular development without germ-soma differentiation JOURNAL Unpublished REFERENCE 2 (bases 1 to 297) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-JUN-2015) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 297) AUTHORS Urushihara,H., Itoh,T., Shin-I,T. and Fujiyama,A. CONSRTM Acytostelium Genome Consortium TITLE Direct Submission JOURNAL Submitted (05-SEP-2014) Contact:Hideko Urushihara University of Tsukuba, Faculty of Life and Environmental Sciences; Tennodai 1-1-1, Tsukuba, Ibaraki 305-8572, Japan COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_012236519). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..297 /organism="Acytostelium subglobosum LB1" /mol_type="mRNA" /strain="LB1" /db_xref="taxon:1410327" /note="scaffold: scaffold14" gene <1..>297 /locus_tag="SAMD00019534_071280" /db_xref="GeneID:24522455" CDS <1..>297 /locus_tag="SAMD00019534_071280" /note="ADB0001979; ASU07164" /codon_start=1 /product="hypothetical protein" /protein_id="XP_012752989.1" /db_xref="GeneID:24522455" /translation="
GQKRYSKRGEEGDPQVQGWSCQEEIVVQPSFRQRCHRFRKEEGIQHPERSKCLSNIVASRPSLSSPVPLRSLQHWTLDHGGQSVLNSPSVLHVNKQPAF"
ORIGIN
ggtcagaaacgctactccaaacgtggagaagaaggagacccgcaagtccaaggttggtcgtgccaagaagagattgttgtacaaccgtcgtttcgtcaacgttgtcaccggtttcggaaagaagaagggatacaacacccagaacgttccaaatgtctaagcaacatagtagcgtcgcgtccgtccctcagtagtcccgtgcctctccgctcattgcaacactggacactcgatcacggaggccagtcggtcctcaacagcccgtctgtcctccacgtaaataaacaaccggctttc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]