LOCUS       XM_009945461             468 bp    mRNA    linear   VRT 28-OCT-2014
DEFINITION  PREDICTED: Opisthocomus hoazin VCP-interacting membrane protein
            (VIMP), mRNA.
ACCESSION   XM_009945461
VERSION     XM_009945461.1
DBLINK      BioProject: PRJNA263612
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Opisthocomus hoazin
  ORGANISM  Opisthocomus hoazin
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Neoaves; Opisthocomiformes;
            Opisthocomidae; Opisthocomus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_009900172.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Opisthocomus hoazin Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 24% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..468
                     /organism="Opisthocomus hoazin"
                     /mol_type="mRNA"
                     /isolate="BGI_N306"
                     /db_xref="taxon:30419"
                     /chromosome="Unknown"
                     /sex="female"
                     /geo_loc_name="Venezuela"
     gene            1..468
                     /gene="VIMP"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 8 Proteins"
                     /db_xref="GeneID:104339310"
     CDS             1..468
                     /gene="VIMP"
                     /codon_start=1
                     /product="selenoprotein S"
                     /protein_id="XP_009943763.1"
                     /db_xref="GeneID:104339310"
                     /translation="

MGREPDTAVVLPRPETRWQIRRDAKRLAPVPVARWRGNPDMVVRRQEALAAARLRMQEELNAQAERYKEKQRQLEEEKRRQKIAMWESMQEGKSYKGNLKLNQQEVESGASTSSAVPKSKPNKRPLRGGGYNPLSGEGGGTCSWRPGRRGPSAGG"

     misc_feature    <115..465
                     /gene="VIMP"
                     /note="Selenoprotein S (SelS); Region: Selenoprotein_S;
                     pfam06936"
                     /db_xref="CDD:462043"
ORIGIN      

atggggcgtgaacccgacacagctgtggtcctgcctcgtccggagacgcgctggcagatccgccgtgacgcgaagcgcttggcgccggttccggtggcacgttggcgtggcaatcctgacatggtggtgagaaggcaggaagctttggcagcggctcgcctcaggatgcaagaggagttgaatgcgcaagcagaaagatacaaagaaaaacaaagacagcttgaagaagagaagcgaaggcagaagatagcaatgtgggaaagtatgcaagagggaaaaagctataaaggaaacctgaaactgaatcagcaagaagtagaatctggtgcctctacctcatcagcagtcccgaaatctaaaccaaacaaaaggcccttgcgaggaggtggctataatcccctgtctggagaaggaggcggaacttgttcctggaggccaggccggagaggcccgtcagcaggtggatga

//