LOCUS       XM_009873103             350 bp    mRNA    linear   VRT 24-OCT-2014
DEFINITION  PREDICTED: Apaloderma vittatum VCP-interacting membrane protein
            (VIMP), partial mRNA.
ACCESSION   XM_009873103
VERSION     XM_009873103.1
DBLINK      BioProject: PRJNA263608
KEYWORDS    RefSeq.
SOURCE      Apaloderma vittatum (bar-tailed trogon)
  ORGANISM  Apaloderma vittatum
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Neoaves; Telluraves;
            Coraciimorphae; Trogoniformes; Trogonidae; Apaloderma.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_009725914.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Apaloderma vittatum Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on the 5' end.
FEATURES             Location/Qualifiers
     source          1..350
                     /organism="Apaloderma vittatum"
                     /mol_type="mRNA"
                     /isolate="BGI_N311"
                     /db_xref="taxon:57397"
                     /chromosome="Unknown"
                     /sex="male"
                     /geo_loc_name="Tanzania"
     gene            <1..350
                     /gene="VIMP"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 5 Proteins"
                     /db_xref="GeneID:104276693"
     CDS             <1..350
                     /gene="VIMP"
                     /codon_start=3
                     /product="selenoprotein S"
                     /protein_id="XP_009871405.1"
                     /db_xref="GeneID:104276693"
                     /translation="

PDVVVRRQEALAAARLRMQEELNAQAERYKERQRQLEEEKRRQKIAMWESMQEGKSYKGNLKLNQPEVESGASSAVPKSKPNKKPLRGGGYNPLSGEGGGTCSWRPGRRGPSAGG"

     misc_feature    <1..347
                     /gene="VIMP"
                     /note="Selenoprotein S (SelS); Region: Selenoprotein_S;
                     pfam06936"
                     /db_xref="CDD:462043"
ORIGIN      

aacccgacgtggtggtgagaaggcaggaagctttggcagcagctcgcctcaggatgcaagaggagttgaacgcacaagcggagagatacaaagaaagacaacgacagcttgaagaagagaaacgaaggcagaagatagcaatgtgggagagtatgcaagaaggaaaaagctataaaggaaacctgaaactgaatcagccagaagtagaatctggtgcctcatcagcagtcccgaaatctaaaccaaacaaaaagcccttgcggggaggtggctataaccccctgtctggagaaggaggtggaacctgttcctggagaccaggccggagaggcccgtcggcaggtggatga

//