2024-11-15 19:27:08, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS XM_008947125 1417 bp mRNA linear VRT 02-SEP-2014 DEFINITION PREDICTED: Merops nubicus vimentin (VIM), partial mRNA. ACCESSION XM_008947125 VERSION XM_008947125.1 DBLINK BioProject: PRJNA253837 KEYWORDS RefSeq. SOURCE Merops nubicus (carmine bee-eater) ORGANISM Merops nubicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Neoaves; Telluraves; Coraciimorphae; Coraciiformes; Meropidae; Merops. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_008630044.1) annotated using gene prediction method: Gnomon, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Merops nubicus Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on the 5' end. FEATURES Location/Qualifiers source 1..1417 /organism="Merops nubicus" /mol_type="mRNA" /isolate="BGI_N331" /db_xref="taxon:57421" /chromosome="Unknown" /sex="female" gene <1..1417 /gene="VIM" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 159 ESTs, 66 Proteins" /db_xref="GeneID:103779500" CDS <1..843 /gene="VIM" /codon_start=1 /product="vimentin" /protein_id="XP_008945373.1" /db_xref="GeneID:103779500" /translation="
SRLQEEMLQREEAENTLQSFRQDVDNASLARLDLERKVESLQEEIVFLKKLHDEEIRELQAQLQEQHIQIDMDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQEANEYRRQIQSLTCEVDALKGSNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRINMPIPTFASLNLRETNIESQPMVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE"
misc_feature <4..672 /gene="VIM" /note="Intermediate filament protein; Region: Filament; pfam00038" /db_xref="CDD:459643" ORIGIN
tccaggttgcaggaggagatgctgcagcgggaggaggccgagaacaccctgcagtctttcagacaggatgttgacaatgcctctctggcacgtcttgatctcgagcgcaaagtcgagtccctgcaagaggagattgttttcttgaagaagcttcatgatgaggaaatcagagaactgcaggcccaactccaggaacagcacatccaaattgatatggatgtttctaagcctgatcttactgctgccctgcgtgacgttcgccaacagtatgaaagcgttgctgctaagaatcttcaggaggctgaagagtggtacaagtccaaatttgcagacctgtctgaagctgctaacaggaacaacgacgcgctgcgccaggccaagcaagaagctaatgagtaccgcaggcagattcagtctctcacctgtgaagttgatgctcttaagggaagcaacgaatccctggagcgccagatgcgtgaaatggaggagaattttgctgttgaagctgctaactaccaagacactattggccgcctgcaggatgagattcagaacatgaaggaagaaatggctcgccatctgcgcgagtaccaggacctgctgaatgtaaagatggctcttgatattgagattgccacctatagaaaactgctggagggtgaagagagcaggattaacatgcctattccaacctttgcctctttgaacctgagagaaaccaacattgagtctcagccaatggtggacactcactcaaagaggacacttctaattaagactgtcgaaactagagatggacaggttattaatgaaacttcccagcatcatgatgacctggagtaaagctgaagtaaagatgcacacttactaatgcaggagaaattcttaccagcaagacttaaaaaaagtccatgtcttaaaggaagaaacagctttcaagtgcctttctgcagtttttccatgagcgcaagattattatgctaggaaataggtcttagatcttgcaaactgactctccctgaaggattagagtttacaatggagtctagtttacaatagcaatatcttgtgccacaatactgttaagtatgtgagttcaataaaactgctttttccagcacattatgagcaacctgtcgctacttcaataaatctctggaaaatggctcttgatgtgttctaatttgttaacttcatgactttctggaaagccataacgtaatgctggaatgactatacggttgacatctccagtactggttgtgtagaatgctgttttttcaatttaactagataaactgtcttactcatttactgcttaggttttggaaccaactaaaatggactataactggcagatgcataatgtattatggtatttcttatcacttgaataaaatctgatacttcaagctaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]