GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-04-05 12:30:53, GGRNA.v2 : RefSeq release 228 (Jan, 2025)

LOCUS       XM_008054490             414 bp    mRNA    linear   PRI 01-JUL-2017
DEFINITION  PREDICTED: Carlito syrichta testis- and ovary-specific PAZ
            domain-containing protein 1-like (LOC103256718), mRNA.
ACCESSION   XM_008054490
VERSION     XM_008054490.1
DBLINK      BioProject: PRJNA236776
KEYWORDS    RefSeq.
SOURCE      Carlito syrichta (Philippine tarsier)
  ORGANISM  Carlito syrichta
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Tarsiiformes; Tarsiidae; Carlito.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_007238869.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Carlito syrichta Annotation Release
                                           101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..414
                     /organism="Carlito syrichta"
                     /mol_type="mRNA"
                     /isolate="Samal-C Ts95f"
                     /db_xref="taxon:1868482"
                     /chromosome="Unknown"
                     /sex="female"
                     /geo_loc_name="USA: Duke University Lemur Center, Durham,
                     NC"
     gene            1..414
                     /gene="LOC103256718"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 ESTs"
                     /db_xref="GeneID:103256718"
     CDS             25..339
                     /gene="LOC103256718"
                     /codon_start=1
                     /product="testis- and ovary-specific PAZ domain-containing
                     protein 1-like"
                     /protein_id="XP_008052681.1"
                     /db_xref="GeneID:103256718"
                     /translation="
MLLAIEIFLVSNASSIQSPGTSTQILQIVLKRCEENKSRSKDDYQAAVERLIMAARISDPKLFIKHMTINVNKEQVYSLEHCSALKWLNENMKWAGKVWLFSNH"
ORIGIN      
ccttcttatttatctgagattgaaatgcttttagctatcgaaatcttcctggtatctaatgctagtagtattcagagtcctggaacttctacacagatactgcagatagttttgaaaaggtgtgaagaaaacaaatctcggagcaaggacgattatcaagctgcagtagaaagattaattatggctgctcgtatatcagatccaaagcttttcattaagcacatgaccatcaatgttaataaggaacaggtttatagtttggaacattgttctgctctgaaatggttgaacgagaatatgaagtgggctggaaaggtttggcttttcagtaaccattagttaataaaggctttttttttaagttaaagtaatcattgttgaaaataaaaggcaataaaaaaatttttcaccata
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]