2025-04-05 12:30:53, GGRNA.v2 : RefSeq release 228 (Jan, 2025)
LOCUS XM_008054490 414 bp mRNA linear PRI 01-JUL-2017 DEFINITION PREDICTED: Carlito syrichta testis- and ovary-specific PAZ domain-containing protein 1-like (LOC103256718), mRNA. ACCESSION XM_008054490 VERSION XM_008054490.1 DBLINK BioProject: PRJNA236776 KEYWORDS RefSeq. SOURCE Carlito syrichta (Philippine tarsier) ORGANISM Carlito syrichta Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Tarsiiformes; Tarsiidae; Carlito. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_007238869.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Carlito syrichta Annotation Release 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..414 /organism="Carlito syrichta" /mol_type="mRNA" /isolate="Samal-C Ts95f" /db_xref="taxon:1868482" /chromosome="Unknown" /sex="female" /geo_loc_name="USA: Duke University Lemur Center, Durham, NC" gene 1..414 /gene="LOC103256718" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 ESTs" /db_xref="GeneID:103256718" CDS 25..339 /gene="LOC103256718" /codon_start=1 /product="testis- and ovary-specific PAZ domain-containing protein 1-like" /protein_id="XP_008052681.1" /db_xref="GeneID:103256718" /translation="
MLLAIEIFLVSNASSIQSPGTSTQILQIVLKRCEENKSRSKDDYQAAVERLIMAARISDPKLFIKHMTINVNKEQVYSLEHCSALKWLNENMKWAGKVWLFSNH"
ORIGIN
ccttcttatttatctgagattgaaatgcttttagctatcgaaatcttcctggtatctaatgctagtagtattcagagtcctggaacttctacacagatactgcagatagttttgaaaaggtgtgaagaaaacaaatctcggagcaaggacgattatcaagctgcagtagaaagattaattatggctgctcgtatatcagatccaaagcttttcattaagcacatgaccatcaatgttaataaggaacaggtttatagtttggaacattgttctgctctgaaatggttgaacgagaatatgaagtgggctggaaaggtttggcttttcagtaaccattagttaataaaggctttttttttaagttaaagtaatcattgttgaaaataaaaggcaataaaaaaatttttcaccata
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]