2024-11-15 19:25:36, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS XM_007374654 300 bp mRNA linear PLN 29-DEC-2023 DEFINITION Spathaspora passalidarum NRRL Y-27907 uncharacterized protein (SPAPADRAFT_55114), partial mRNA. ACCESSION XM_007374654 VERSION XM_007374654.1 DBLINK BioProject: PRJNA225527 BioSample: SAMN00714472 KEYWORDS RefSeq. SOURCE Spathaspora passalidarum NRRL Y-27907 ORGANISM Spathaspora passalidarum NRRL Y-27907 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Spathaspora. REFERENCE 1 (bases 1 to 300) AUTHORS Wohlbach,D.J., Kuo,A., Sato,T.K., Potts,K.M., Salamov,A.A., Labutti,K.M., Sun,H., Clum,A., Pangilinan,J.L., Lindquist,E.A., Lucas,S., Lapidus,A., Jin,M., Gunawan,C., Balan,V., Dale,B.E., Jeffries,T.W., Zinkel,R., Barry,K.W., Grigoriev,I.V. and Gasch,A.P. TITLE Comparative genomics of xylose-fermenting fungi for enhanced biofuel production JOURNAL Proc. Natl. Acad. Sci. U.S.A. 108 (32), 13212-13217 (2011) PUBMED 21788494 REFERENCE 2 (bases 1 to 300) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (28-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 300) AUTHORS Kuo,A., LaButti,K.M., Sun,H., Clum,A., Pangilinan,J., Lindquist,E., Barry,K., Lucas,S., Lapidus,A., Wohlbach,D.J., Potts,K.M., Jeffries,T.W., Zinkel,R., Gasch,A.P. and Grigoriev,I.V. CONSRTM US DOE Joint Genome Institute (JGI-PGF) TITLE Direct Submission JOURNAL Submitted (10-MAY-2011) US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_006767427). ##Metadata-START## Organism Display Name :: Spathaspora passalidarum NRRL Y-27907 GOLD Stamp ID :: Gi04859 ##Metadata-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..300 /organism="Spathaspora passalidarum NRRL Y-27907" /mol_type="mRNA" /strain="NRRL Y-27907" /type_material="type material of Spathaspora passalidarum" /db_xref="taxon:619300" /chromosome="Unknown" gene <1..>300 /locus_tag="SPAPADRAFT_55114" /db_xref="GeneID:18871909" CDS 1..300 /locus_tag="SPAPADRAFT_55114" /codon_start=1 /transl_table=12 /product="uncharacterized protein" /protein_id="XP_007374716.1" /db_xref="GeneID:18871909" /db_xref="InterPro:IPR000509" /db_xref="JGIDB:Spapa3_55114" /translation="
MAKSGIAAGLNKGHKTTAKEVAPKVSYRKGALSKRADFVRNIVKEVAGLAPYERRLIELIRNAGEKRAKKLAKKRLGTHKRALRKVEEMNKVIAESRRH"
misc_feature 7..294 /locus_tag="SPAPADRAFT_55114" /note="Ribosomal protein L36e; Region: Ribosomal_L36e; pfam01158" /db_xref="CDD:460088" ORIGIN
atggctaagtcaggtattgctgctggtttaaacaagggtcacaagactaccgctaaggaagtcgctccaaaggtttcctacagaaagggtgctttaagtaagagagctgactttgtcagaaacatcgtcaaggaagttgctggtttagccccatacgaaagaagattgattgaattgatcagaaacgccggtgaaaagagagctaagaagttggccaagaagagattgggtacccacaagagagctttaagaaaggttgaagaaatgaacaaggtcattgctgaatctagaagacactaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]