GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-04-22 02:14:46, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       XM_004714241             795 bp    mRNA    linear   MAM 06-DEC-2021
DEFINITION  PREDICTED: Echinops telfairi alkaline ceramidase 1 (ACER1), mRNA.
ACCESSION   XM_004714241
VERSION     XM_004714241.1
DBLINK      BioProject: PRJNA193504
KEYWORDS    RefSeq.
SOURCE      Echinops telfairi (small Madagascar hedgehog)
  ORGANISM  Echinops telfairi
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Afrotheria; Tenrecidae; Tenrecinae; Echinops.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_022111359.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Echinops telfairi Annotation Release
                                           103
            Annotation Version          :: 103
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..795
                     /organism="Echinops telfairi"
                     /mol_type="mRNA"
                     /isolate="266"
                     /db_xref="taxon:9371"
                     /chromosome="Unknown"
                     /sex="female"
                     /geo_loc_name="Germany: Ludwig Maximilians University,
                     Munich"
     gene            1..795
                     /gene="ACER1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins"
                     /db_xref="GeneID:101663034"
     CDS             1..795
                     /gene="ACER1"
                     /codon_start=1
                     /product="alkaline ceramidase 1"
                     /protein_id="XP_004714298.1"
                     /db_xref="GeneID:101663034"
                     /translation="
MPSIFAYQSSEVDWCEINFQYSELVAEFYNTISNVTFLILGPLMMFLMHPYAKQRTLYVHCIWILFVVIGLFSTYFHMTLSFLGQLLDELSILWLLASGYCIWMPRCYYPAFIRKNRTHFTCLVILITVVSSFLSFLRPTVNAYALNSIAFHILYIVVREYRKSNSRELRHILQVSTVLWAISLTSWLSDRLLCSFWQRIHFSYLHSIWHVLICFTFPYGTMAMVLVDANYELPGQTLKIHYWPRDTWPVGIPYVEIRNDDKNC"
     misc_feature    16..768
                     /gene="ACER1"
                     /note="Region: Ceramidase; pfam05875"
                     /db_xref="CDD:461766"
ORIGIN      
atgcccagcatcttcgcctaccagagctcggaagtggactggtgtgagatcaacttccagtactcagagctagtggctgagttctacaacacgatcagcaatgtcaccttcctcatcctcgggccactcatgatgttcctgatgcacccttacgccaaacagcgcactctttacgttcactgcatttggatcctctttgtggtcattggcctgttctccacgtacttccacatgaccctgagcttcctggggcagctgctggatgagctctccatcctgtggctgctggccagtggctactgcatctggatgccacgctgctactacccggccttcattcggaagaacaggacccacttcacctgcctcgtcatcctcatcacggtggtcagcagcttcctgtccttcctgcggcccacggtcaacgcctacgccctcaacagcatcgccttccacatcctctacatcgtagtgcgggagtacaggaagagcaacagcagggagctgcggcacattctccaggtcagcacggtcctgtgggcgatctccctgaccagctggctcagcgaccggctgctctgtagcttctggcagagaatacatttctcttacctccacagcatctggcatgtgctcatctgcttcaccttcccctatggcaccatggccatggtcttggtggatgccaactatgaattgccaggccagacactcaaaatccactactggcctcgggacacatggcccgtggggataccctatgtggaaatcaggaatgatgacaagaactgctga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]