2025-04-22 02:14:46, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_004714241 795 bp mRNA linear MAM 06-DEC-2021 DEFINITION PREDICTED: Echinops telfairi alkaline ceramidase 1 (ACER1), mRNA. ACCESSION XM_004714241 VERSION XM_004714241.1 DBLINK BioProject: PRJNA193504 KEYWORDS RefSeq. SOURCE Echinops telfairi (small Madagascar hedgehog) ORGANISM Echinops telfairi Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Afrotheria; Tenrecidae; Tenrecinae; Echinops. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_022111359.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Echinops telfairi Annotation Release 103 Annotation Version :: 103 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..795 /organism="Echinops telfairi" /mol_type="mRNA" /isolate="266" /db_xref="taxon:9371" /chromosome="Unknown" /sex="female" /geo_loc_name="Germany: Ludwig Maximilians University, Munich" gene 1..795 /gene="ACER1" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:101663034" CDS 1..795 /gene="ACER1" /codon_start=1 /product="alkaline ceramidase 1" /protein_id="XP_004714298.1" /db_xref="GeneID:101663034" /translation="
MPSIFAYQSSEVDWCEINFQYSELVAEFYNTISNVTFLILGPLMMFLMHPYAKQRTLYVHCIWILFVVIGLFSTYFHMTLSFLGQLLDELSILWLLASGYCIWMPRCYYPAFIRKNRTHFTCLVILITVVSSFLSFLRPTVNAYALNSIAFHILYIVVREYRKSNSRELRHILQVSTVLWAISLTSWLSDRLLCSFWQRIHFSYLHSIWHVLICFTFPYGTMAMVLVDANYELPGQTLKIHYWPRDTWPVGIPYVEIRNDDKNC"
misc_feature 16..768 /gene="ACER1" /note="Region: Ceramidase; pfam05875" /db_xref="CDD:461766" ORIGIN
atgcccagcatcttcgcctaccagagctcggaagtggactggtgtgagatcaacttccagtactcagagctagtggctgagttctacaacacgatcagcaatgtcaccttcctcatcctcgggccactcatgatgttcctgatgcacccttacgccaaacagcgcactctttacgttcactgcatttggatcctctttgtggtcattggcctgttctccacgtacttccacatgaccctgagcttcctggggcagctgctggatgagctctccatcctgtggctgctggccagtggctactgcatctggatgccacgctgctactacccggccttcattcggaagaacaggacccacttcacctgcctcgtcatcctcatcacggtggtcagcagcttcctgtccttcctgcggcccacggtcaacgcctacgccctcaacagcatcgccttccacatcctctacatcgtagtgcgggagtacaggaagagcaacagcagggagctgcggcacattctccaggtcagcacggtcctgtgggcgatctccctgaccagctggctcagcgaccggctgctctgtagcttctggcagagaatacatttctcttacctccacagcatctggcatgtgctcatctgcttcaccttcccctatggcaccatggccatggtcttggtggatgccaactatgaattgccaggccagacactcaaaatccactactggcctcgggacacatggcccgtggggataccctatgtggaaatcaggaatgatgacaagaactgctga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]