LOCUS       XM_002999537             303 bp    mRNA    linear   PLN 10-JUN-2024
DEFINITION  Nakaseomyces glabratus 60S ribosomal protein eL36 (GVI51_K10725),
            partial mRNA.
ACCESSION   XM_002999537
VERSION     XM_002999537.1
DBLINK      BioProject: PRJNA1120907
            BioSample: SAMN13613350
KEYWORDS    RefSeq.
SOURCE      Nakaseomyces glabratus (Candida glabrata)
  ORGANISM  Nakaseomyces glabratus
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Nakaseomyces.
REFERENCE   1  (bases 1 to 303)
  AUTHORS   Xu,Z., Green,B., Benoit,N., Schatz,M., Wheelan,S. and Cormack,B.
  TITLE     De novo genome assembly of Candida glabrata reveals cell wall
            protein complement and structure of dispersed tandem repeat arrays
  JOURNAL   Mol. Microbiol. 113 (6), 1209-1224 (2020)
   PUBMED   32068314
REFERENCE   2  (bases 1 to 303)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (06-JUN-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 303)
  AUTHORS   Xu,Z., Green,B., Benoit,N., Schatz,M., Wheelan,S. and Cormack,B.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-JAN-2020) Molecular Biology and Genetics, Johns
            Hopkins Medical Institution, 725 N Wolfe St, Baltimore, MD 21205,
            USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_088961).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..303
                     /organism="Nakaseomyces glabratus"
                     /mol_type="mRNA"
                     /strain="ATCC 2001"
                     /isolation_source="feces"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:2001"
                     /type_material="type material of Cryptococcus glabratus"
                     /db_xref="taxon:5478"
                     /chromosome="K"
                     /collection_date="1917"
                     /collected_by="Anderson"
     gene            <1..>303
                     /locus_tag="GVI51_K10725"
                     /old_locus_tag="CAGL0K10906g"
                     /note="CAGL0K10906g;
                     Ortholog(s) have RNA binding, structural constituent of
                     ribosome activity, role in cytoplasmic translation and
                     cytosolic large ribosomal subunit localization"
                     /db_xref="GeneID:9488035"
     CDS             1..303
                     /locus_tag="GVI51_K10725"
                     /old_locus_tag="CAGL0K10906g"
                     /note="CAGL0K10906g;
                     Ortholog(s) have RNA binding, structural constituent of
                     ribosome activity, role in cytoplasmic translation and
                     cytosolic large ribosomal subunit localization"
                     /codon_start=1
                     /product="60S ribosomal protein eL36"
                     /protein_id="XP_002999583.1"
                     /db_xref="GeneID:9488035"
                     /translation="

MAVKTGIAVGLNKGTKVTQMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNAGEKRARKVAKKRLGSFTRAKAKVEEMNSIIAASRRH"

     misc_feature    10..297
                     /locus_tag="GVI51_K10725"
                     /old_locus_tag="CAGL0K10906g"
                     /note="Ribosomal protein L36e; Region: Ribosomal_L36e;
                     pfam01158"
                     /db_xref="CDD:460088"
ORIGIN      

atggccgttaagactggtattgctgttggtttgaacaagggtactaaggtcacccaaatgaccccagccccaaagatctcttacaagaagggtgctgcttctaacagaaccaagttcgttcgttctttggtcagagaaatcgctggtttgtctccatacgaaagaagattgatcgatttgatcagaaacgccggtgaaaagagagctagaaaggtcgccaagaagagattgggttctttcaccagagctaaggctaaggttgaagaaatgaactccatcattgctgcttctcgtcgtcactaa

//