ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-01-09 02:23:46, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_210741 303 bp mRNA linear PLN 15-JUL-2025
DEFINITION Eremothecium gossypii ATCC 10895 60S ribosomal protein eL36
(AGOS_AFL163C), partial mRNA.
ACCESSION NM_210741
VERSION NM_210741.1
DBLINK BioProject: PRJNA10623
BioSample: SAMN03081415
KEYWORDS RefSeq.
SOURCE Eremothecium gossypii ATCC 10895 (Ashbya gossypii ATCC 10895)
ORGANISM Eremothecium gossypii ATCC 10895
Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
Eremothecium.
REFERENCE 1 (bases 1 to 303)
AUTHORS Dietrich,F.S., Voegeli,S., Brachat,S., Lerch,A., Gates,K.,
Steiner,S., Mohr,C., Pohlmann,R., Luedi,P., Choi,S., Wing,R.A.,
Flavier,A., Gaffney,T.D. and Philippsen,P.
TITLE The Ashbya gossypii genome as a tool for mapping the ancient
Saccharomyces cerevisiae genome
JOURNAL Science 304 (5668), 304-307 (2004)
PUBMED 15001715
REFERENCE 2 (bases 1 to 303)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (14-JUL-2025) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 303)
AUTHORS Dietrich,F.S., Voegeli,S. and Philippsen,P.
TITLE Direct Submission
JOURNAL Submitted (18-OCT-2010) Biozentrum, Klingelbergstrasse 50, Basel
CH-4056, Switzerland
REMARK Protein update by submitter
REFERENCE 4 (bases 1 to 303)
AUTHORS Dietrich,F.S., Voegeli,S. and Philippsen,P.
TITLE Direct Submission
JOURNAL Submitted (03-JUN-2010) Biozentrum, Klingelbergstrasse 50, Basel
CH-4056, Switzerland
REMARK Sequence update by submitter
REFERENCE 5 (bases 1 to 303)
AUTHORS Lerch,A., Brachat,S., Voegeli,S.E., Gaffney,T., Philippsen,P. and
Dietrich,F.S.
TITLE Direct Submission
JOURNAL Submitted (09-AUG-2007) Biozentrum, Klingelbergstrasse 50, Basel
CH-4056, Switzerland
REMARK Sequence update by submitter
REFERENCE 6 (bases 1 to 303)
AUTHORS Lerch,A., Brachat,S., Voegeli,S.E., Gaffney,T., Philippsen,P. and
Dietrich,F.S.
TITLE Direct Submission
JOURNAL Submitted (20-DEC-2002) Biozentrum, Klingelbergstrasse 50, Basel
CH-4056, Switzerland
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. This record is derived from an annotated genomic
sequence (NC_005787).
COMPLETENESS: incomplete on both ends.
FEATURES Location/Qualifiers
source 1..303
/organism="Eremothecium gossypii ATCC 10895"
/mol_type="mRNA"
/strain="ATCC 10895"
/culture_collection="ATCC:10895"
/db_xref="taxon:284811"
/chromosome="VI"
gene <1..>303
/locus_tag="AGOS_AFL163C"
/old_locus_tag="AFL163C"
/db_xref="GeneID:4621613"
CDS 1..303
/locus_tag="AGOS_AFL163C"
/old_locus_tag="AFL163C"
/note="Syntenic homolog of Saccharomyces cerevisiae
YPL249C-A (RPL36B) and YMR194W (RPL36A); 1-intron"
/codon_start=1
/product="60S ribosomal protein eL36"
/protein_id="NP_985387.1"
/db_xref="GeneID:4621613"
/translation="
MAVKSGIAVGLNKGKKVTPMTPAPKVSYRKGASSKRTTFVRSIVREVAGMAPYERRLIDLIRNAGEKRARKVAKKRLGTFGRAKAKVEEMNEIIAASRRH"
misc_feature 10..297
/locus_tag="AGOS_AFL163C"
/old_locus_tag="AFL163C"
/note="Ribosomal protein L36e; Region: Ribosomal_L36e;
pfam01158"
/db_xref="CDD:460088"
ORIGIN
atggctgttaaatctggtattgctgttggtttgaacaagggtaagaaggtcaccccaatgacccctgctccaaaggtctcttacagaaagggtgcctcctccaagagaaccaccttcgtcagatctatcgtcagagaggttgccggcatggccccatacgagagaagattgatcgacttgatcagaaacgccggtgagaagagagccagaaaggtcgccaagaagagattgggcacctttggcagagctaaggctaaggttgaggaaatgaacgagatcattgctgcttctagacgtcactag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]