GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-15 19:41:42, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       NM_126068                941 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana homeobox 53 (HB53), mRNA.
ACCESSION   NM_126068
VERSION     NM_126068.3
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 941)
  AUTHORS   Tabata,S., Kaneko,T., Nakamura,Y., Kotani,H., Kato,T., Asamizu,E.,
            Miyajima,N., Sasamoto,S., Kimura,T., Hosouchi,T., Kawashima,K.,
            Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
            Nakazaki,N., Naruo,K., Okumura,S., Shinpo,S., Takeuchi,C., Wada,T.,
            Watanabe,A., Yamada,M., Yasuda,M., Sato,S., de la Bastide,M.,
            Huang,E., Spiegel,L., Gnoj,L., O'Shaughnessy,A., Preston,R.,
            Habermann,K., Murray,J., Johnson,D., Rohlfing,T., Nelson,J.,
            Stoneking,T., Pepin,K., Spieth,J., Sekhon,M., Armstrong,J.,
            Becker,M., Belter,E., Cordum,H., Cordes,M., Courtney,L.,
            Courtney,W., Dante,M., Du,H., Edwards,J., Fryman,J., Haakensen,B.,
            Lamar,E., Latreille,P., Leonard,S., Meyer,R., Mulvaney,E.,
            Ozersky,P., Riley,A., Strowmatt,C., Wagner-McPherson,C., Wollam,A.,
            Yoakum,M., Bell,M., Dedhia,N., Parnell,L., Shah,R., Rodriguez,M.,
            See,L.H., Vil,D., Baker,J., Kirchoff,K., Toth,K., King,L.,
            Bahret,A., Miller,B., Marra,M., Martienssen,R., McCombie,W.R.,
            Wilson,R.K., Murphy,G., Bancroft,I., Volckaert,G., Wambutt,R.,
            Dusterhoft,A., Stiekema,W., Pohl,T., Entian,K.D., Terryn,N.,
            Hartley,N., Bent,E., Johnson,S., Langham,S.A., McCullagh,B.,
            Robben,J., Grymonprez,B., Zimmermann,W., Ramsperger,U., Wedler,H.,
            Balke,K., Wedler,E., Peters,S., van Staveren,M., Dirkse,W.,
            Mooijman,P., Lankhorst,R.K., Weitzenegger,T., Bothe,G., Rose,M.,
            Hauf,J., Berneiser,S., Hempel,S., Feldpausch,M., Lamberth,S.,
            Villarroel,R., Gielen,J., Ardiles,W., Bents,O., Lemcke,K.,
            Kolesov,G., Mayer,K., Rudd,S., Schoof,H., Schueller,C.,
            Zaccaria,P., Mewes,H.W., Bevan,M. and Fransz,P.
  CONSRTM   Kazusa DNA Research Institute; Cold Spring Harbor and Washington
            University in St Louis Sequencing Consortium; European Union
            Arabidopsis Genome Sequencing Consortium
  TITLE     Sequence and analysis of chromosome 5 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 823-826 (2000)
   PUBMED   11130714
REFERENCE   2  (bases 1 to 941)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 941)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 941)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003076).
            
            On Sep 12, 2016 this sequence version replaced NM_126068.2.
FEATURES             Location/Qualifiers
     source          1..941
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="5"
                     /ecotype="Columbia"
     gene            1..941
                     /gene="HB53"
                     /locus_tag="AT5G66700"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 53; ATHB53;
                     HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9"
                     /note="Encodes a homeodomain protein. Member of HD-ZIP 1
                     family, most closely related to HB5. AtHB53 is
                     auxin-inducible and its induction is inhibited by
                     cytokinin, especially in roots therefore may be involved
                     in root development."
                     /db_xref="Araport:AT5G66700"
                     /db_xref="GeneID:836803"
                     /db_xref="TAIR:AT5G66700"
     CDS             132..818
                     /gene="HB53"
                     /locus_tag="AT5G66700"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 53; ATHB53;
                     HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR750230.1,INSD:DR229968.1,INSD:DR750666.1,
                     INSD:DR750667.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BT024847.1,INSD:AY683477.1"
                     /note="homeobox 53 (HB53); FUNCTIONS IN: DNA binding,
                     sequence-specific DNA binding transcription factor
                     activity; INVOLVED IN: response to auxin stimulus,
                     regulation of transcription, DNA-dependent, root
                     development; LOCATED IN: nucleus; EXPRESSED IN: 16 plant
                     structures; EXPRESSED DURING: 8 growth stages; CONTAINS
                     InterPro DOMAIN/s: Homeobox, conserved site
                     (InterPro:IPR017970), Homeobox (InterPro:IPR001356),
                     Homeodomain-like (InterPro:IPR009057), Helix-turn-helix
                     motif, lambda-like repressor (InterPro:IPR000047),
                     Homeodomain-related (InterPro:IPR012287); BEST Arabidopsis
                     thaliana protein match is: homeobox protein 40
                     (TAIR:AT4G36740.1); Has 1807 Blast hits to 1807 proteins
                     in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736;
                     Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes -
                     339 (source: NCBI BLink)."
                     /codon_start=1
                     /product="homeobox 53"
                     /protein_id="NP_201471.1"
                     /db_xref="GeneID:836803"
                     /db_xref="TAIR:AT5G66700"
                     /db_xref="Araport:AT5G66700"
                     /translation="
MDHGRLMDDQMMLGSQVYPYTTQPQNSHCIIVNQIDGGEESKPVKRRRKRRSKGSSATNEEDVAEIGGMLRKRKLTDEQVNMLEYSFGNEHKLESGRKEKIAGELGLDPRQVAVWFQNRRARWKNKKLEEEYAKLKNHHDNVVLGQCQLESQILKLTEQLSEAQSEIRKLSERLEEMPTNSSSSSLSVEANNAPTDFELAPETNYNIPFYMLDNNYLQSMEYWDGLYV"
     misc_feature    342..506
                     /gene="HB53"
                     /locus_tag="AT5G66700"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 53; ATHB53;
                     HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
ORIGIN      
cacagtcgttgaggttataaaaagcatctcataggactcaacctcaccaaagtcatatcctattgcatcactctcctttaaacacagtcagagaaaacagcaactcttgtctgaaaaactagagagagaaaatggatcatggtaggttaatggatgatcaaatgatgctaggctctcaagtgtacccctacacgacccaaccccaaaattcacactgcatcatcgttaaccagatcgatggaggcgaagaatcaaaaccggtgaagcggaggaggaagaggaggagtaaaggttcatcagccaccaacgaagaagacgtggcggagatcggagggatgttgaggaagaggaagttgaccgatgaacaagtgaacatgctcgaatatagcttcgggaacgagcataagctggagtcagggaggaaggagaagatcgccggagagttaggtcttgacccgagacaggtggctgtttggttccagaaccgccgtgcacgttggaagaacaagaaactagaggaagagtacgccaaactcaaaaaccaccacgacaacgtcgtactcggccaatgccaactcgagtctcagatattgaaactaacagaacaattgagtgaagctcaaagtgaaattcgaaaactgtcggaacgacttgaagaaatgccaaccaacagttcaagttcatcgctttctgttgaagccaacaatgcaccaactgatttcgagcttgccccggaaactaattataacatcccgttttatatgttagataataattatttacaaagcatggagtattgggatggtttgtatgtataatcagtttatcaactaaatatctcgtgctttattgatgcaactcatgttattataagtaatgtagaaataggtgttggtgaaacggttgtaattatgtgttgttttcagtatttattttaatat
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]