GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-04-19 10:40:43, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       XM_031896445            1173 bp    mRNA    linear   VRT 18-DEC-2019
DEFINITION  PREDICTED: Xenopus tropicalis family with sequence similarity 162
            member A (fam162a), mRNA.
ACCESSION   XM_031896445
VERSION     XM_031896445.1
DBLINK      BioProject: PRJNA205740
KEYWORDS    RefSeq.
SOURCE      Xenopus tropicalis (tropical clawed frog)
  ORGANISM  Xenopus tropicalis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Silurana.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_030678.2) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Xenopus tropicalis Annotation
                                           Release 104
            Annotation Version          :: 104
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.3
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1173
                     /organism="Xenopus tropicalis"
                     /mol_type="mRNA"
                     /strain="Nigerian"
                     /db_xref="taxon:8364"
                     /chromosome="2"
                     /sex="female"
                     /tissue_type="liver and blood"
                     /dev_stage="adult"
                     /note="F17 inbred"
     gene            1..1173
                     /gene="fam162a"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 36 ESTs, 3 Proteins, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 129 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:100490517"
                     /db_xref="Xenbase:XB-GENE-997367"
     CDS             273..746
                     /gene="fam162a"
                     /codon_start=1
                     /product="protein FAM162A"
                     /protein_id="XP_031752305.1"
                     /db_xref="GeneID:100490517"
                     /db_xref="Xenbase:XB-GENE-997367"
                     /translation="
MWGAALRRSGLRSLVERVTVLRGGSVPTHNPLPTRTLGIPRWLCSKPQEVKPKEPGVTFKVPGHRPTDFEKKILVWGGRFKKQEDIPELVTYDMVEMAKSKVRVKVSYLMILMTILGCIAMVVSGKQAAARHESLASFNLEKKARLKDELQKEEIAK"
     misc_feature    369..677
                     /gene="fam162a"
                     /note="Protein of unknown function (DUF1075); Region:
                     DUF1075; pfam06388"
                     /db_xref="CDD:461893"
ORIGIN      
cacaaggaaatacagctcggaaagccatctccctgcaccgtgttctgcgcactgtaactgagtgtaactatcagagggggcagtacggccctgacacggacagctacaataagcaccccggaaatacatttggcacgcacgttgcgttccacgcaattacacaatatatcccgcctctgcaagcgtattggttgtctgcggacgcgggcgtgcctataacaacacgtgactccgggcccgctgacagagagcggctgcctcttgccttgaggatgtggggagcagcgctgaggaggagcgggctgcgctcattggtcgagcgagtgactgtgctgagaggaggctctgtgcccactcacaaccctctgccaacacggacgttggggatcccgagatggctgtgcagcaaaccccaagaggtgaagcccaaagagcctggggttacattcaaggtaccaggacacagacccaccgactttgaaaagaagattctggtgtggggcggtcgctttaaaaaacaagaggatatacctgaacttgtgacgtacgacatggtggagatggctaagagcaaggtgcgggtgaaggtctcctacctcatgatcctaatgaccatcctgggctgcatcgccatggtggtgtctgggaagcaggcggccgctcggcacgagtctctggccagtttcaacctggagaagaaggcgcggttgaaagatgagttgcagaaggaggagatcgccaagtaggagtgacacgaggatctgatacccccgcaccgtgccccccacacgtagtctgtagaggttctagacagtgggtgcccaccgctctctgccctgttgctgaactgccctcctcgtcattgtgctgctgcccatctgccctcgccagtcattggtaccagtagttctattgccatgatgtttggattgagactcggtgtctcctacatatctaggggcagcaatgggttaattaaaggagttactgcctgcagatccatctgtgtctcattgttcagccggaccaaccgcatcggaaacagcatcgtttaattgcagtctcggtaccggatgtgggaattgtagcaaatgcaggttctgggcccataataaacgctaatgttccctttcctcttgttcgtttggtggaaataaaggttctgccccagtg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]