2025-04-19 10:45:32, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_004910920 682 bp mRNA linear VRT 18-DEC-2019 DEFINITION PREDICTED: Xenopus tropicalis ribosomal protein L9 (rpl9), transcript variant X2, mRNA. ACCESSION XM_004910920 VERSION XM_004910920.4 DBLINK BioProject: PRJNA205740 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_030677.2) annotated using gene prediction method: Gnomon, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process On Dec 18, 2019 this sequence version replaced XM_004910920.3. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Xenopus tropicalis Annotation Release 104 Annotation Version :: 104 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.3 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..682 /organism="Xenopus tropicalis" /mol_type="mRNA" /strain="Nigerian" /db_xref="taxon:8364" /chromosome="1" /sex="female" /tissue_type="liver and blood" /dev_stage="adult" /note="F17 inbred" gene 1..682 /gene="rpl9" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 686 ESTs, 16 Proteins, and 95% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:100379906" /db_xref="Xenbase:XB-GENE-964745" CDS 47..625 /gene="rpl9" /codon_start=1 /product="60S ribosomal protein L9 isoform X2" /protein_id="XP_004910977.1" /db_xref="GeneID:100379906" /db_xref="Xenbase:XB-GENE-964745" /translation="
MKTILSNQIVDIPENVDISLKGRTVTVKGPRGVLRKNFNHINVELCLLGKKKRRLRVDKWWGNRKELATVRTICSHVQNMVKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRSGVACALSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQVEE"
misc_feature 47..619 /gene="rpl9" /note="60S ribosomal protein L6; Provisional; Region: PTZ00027" /db_xref="CDD:240234" ORIGIN
acgtaatgacgacacacgctttccctttcctctgtcagctgcgagaatgaagaccattctcagcaaccagattgttgacatcccagagaatgttgacatctctctgaagggccgtacagttactgtaaaggggcccagaggtgtcctgcggaaaaactttaaccacatcaatgttgagctgtgtcttctgggcaagaagaagaggaggctccgggttgacaaatggtggggtaacagaaaagaactggccacagtgcgcaccatctgcagtcatgtgcaaaacatggtgaaaggagtcacactgggctttcgttacaaaatgagatctgtgtatgctcactttcccatcaacgttgtcattcaggagaatggatctcttgtggaaataagaaacttcttgggtgaaaagtatatccgcagggttcgcatgagatcaggtgttgcatgcgccttatcccaagcccagaaagatgagctgattcttgaaggcaatgacattgaacttgtatcaaactctgctgccttgatccagcaagccaccacagtaaagaataaggatatcagaaaattcttggatggtatctacgtatccgaaaagggtacagtacagcaggttgaagaataaaagcctgcaaaagtctggttcctgtactgttccaaaaataaagtccctttatctaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]