2025-04-19 10:50:46, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_203595 924 bp mRNA linear VRT 22-DEC-2019 DEFINITION Xenopus tropicalis B-cell translocation gene 1, anti-proliferative (btg1), mRNA. ACCESSION NM_203595 VERSION NM_203595.1 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana. REFERENCE 1 (bases 1 to 924) AUTHORS Klein SL, Strausberg RL, Wagner L, Pontius J, Clifton SW and Richardson P. TITLE Genetic and genomic tools for Xenopus research: The NIH Xenopus initiative JOURNAL Dev. Dyn. 225 (4), 384-391 (2002) PUBMED 12454917 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC061606.1. ##Evidence-Data-START## Transcript exon combination :: BC061606.1, DT440324.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMD00028290, SAMD00028291 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..924 /organism="Xenopus tropicalis" /mol_type="mRNA" /db_xref="taxon:8364" /chromosome="3" /map="3" gene 1..924 /gene="btg1" /gene_synonym="xbtg1" /note="B-cell translocation gene 1, anti-proliferative" /db_xref="GeneID:394522" /db_xref="Xenbase:XB-GENE-1002920" misc_feature 83..85 /gene="btg1" /gene_synonym="xbtg1" /note="upstream in-frame stop codon" CDS 182..691 /gene="btg1" /gene_synonym="xbtg1" /codon_start=1 /product="protein BTG1" /protein_id="NP_988926.1" /db_xref="GeneID:394522" /db_xref="Xenbase:XB-GENE-1002920" /translation="
MHTHYPWANMKPEIMAAVSFISKFLRTKGLMNDLDLQTFNQSLQELLADHYKHHWFPEKPSRGSAYRCIRINHKMDPLIGEAADRIGLNSQQMFKLLPSELTLWVDPYEVSYRIGEDGSICVLYESVPGGGISPSSSGSLVESRISCKDELLLGRTSPSKTYNMMTVSG"
misc_feature 209..553 /gene="btg1" /gene_synonym="xbtg1" /note="BTG family; Region: BTG; pfam07742" /db_xref="CDD:462251" ORIGIN
attaacttgcacgccatgccagggcgcagcttgtaaaaccaccaaggacgtaaaagtgaaaaatataaaaaaaaaaaaattgtaaaacacgaataaaaatccatcaaacaggaccaagcggagcgcaatagacgatccgtgctgttccatcggtgttcgtatcgctgtcggtcgcgctcccatgcatacgcactatccctgggccaacatgaagccagagatcatggcggcggtgagtttcatctcaaagttcctccgaaccaaaggcctcatgaacgacctcgacctgcagacgtttaaccagtctttacaggagctcctggccgatcactataagcatcattggtttccagaaaagccgtcaaggggttcagcctatcgatgtattcggattaaccacaagatggaccctttaattggagaggcagcagatcgtattggactcaacagccagcaaatgtttaagcttctgccaagtgaacttactttgtgggttgacccatatgaagtatcgtatcgcataggagaggatggctctatttgtgtattgtatgaatctgttccaggaggtggtattagtccaagcagcagtggctctctagttgagagtaggatcagctgtaaagatgaactcctcttgggccgaacaagcccatccaaaacgtacaacatgatgactgtatctggttaagatatggttgatggctggatcatcttgtagcagatggaaaccaattattgtttttaatttgggagggctcctatggggatggattgtgaagtttatacaatgacgcagctgtgaagattggacacaaatagtggtagatctttctgaagtgaaagtgcctttgtttagacagtgtctttggcaattttatagcctgttatttacgcaaatagatttaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]