2025-04-19 10:46:27, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001016826 2070 bp mRNA linear VRT 03-APR-2024 DEFINITION Xenopus tropicalis UBA domain containing 1 (ubac1), mRNA. ACCESSION NM_001016826 VERSION NM_001016826.2 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana. REFERENCE 1 (bases 1 to 2070) AUTHORS Gaudet,P., Livstone,M.S., Lewis,S.E. and Thomas,P.D. TITLE Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium JOURNAL Brief Bioinform 12 (5), 449-462 (2011) PUBMED 21873635 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CR855524.2. On Oct 14, 2005 this sequence version replaced NM_001016826.1. ##Evidence-Data-START## Transcript exon combination :: CR855524.2 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00861988, SAMN00861989 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..2070 /organism="Xenopus tropicalis" /mol_type="mRNA" /db_xref="taxon:8364" /chromosome="8" /map="8" gene 1..2070 /gene="ubac1" /gene_synonym="kpc2; ubadc1" /note="UBA domain containing 1" /db_xref="GeneID:549580" /db_xref="Xenbase:XB-GENE-997434" CDS 36..1256 /gene="ubac1" /gene_synonym="kpc2; ubadc1" /note="ubiquitin associated domain containing 1; UBA domain-containing protein 1; E3 ubiquitin-protein ligase subunit KPC2; kip1 ubiquitination-promoting complex protein 2" /codon_start=1 /product="ubiquitin-associated domain-containing protein 1" /protein_id="NP_001016826.1" /db_xref="GeneID:549580" /db_xref="Xenbase:XB-GENE-997434" /translation="
MFVQEEKIFAGKGLRLHICSLDGAEWLEEVTEEITVEKLKEKCLKHCSHGSLEDPKSLTHHKLVHASSERVLSDTKTLAEENLQDNDVLLLVKKRAPPPTPKMAEVSADEKRKQDQKAPDKDAILKATAGLPARSTDRTVAQHNMRDFQTELRKILVSLIEVAQKLLALNPDAIELFKKANAMLDEDDEDRVDEVALRQLTEMGFPESRAVKALRLNHMSVTQAMEWLIEHADDPAADAPLPCENSSEAAGGLATGEAETKPTLGAGAEDPKDELTEIFKKIRRKREFRPDPRAVIALMEMGFDEKEVIDALRVNNNQQDAACEWLLGDRKPSPEDLDKGIDTTSPLFQAILDNPVVQLGLTNPKTLLAFEDMLENPLNSTQWMNDPETGPVMLQISRIFQTLNRT"
misc_feature 60..320 /gene="ubac1" /gene_synonym="kpc2; ubadc1" /note="first ubiquitin-like (Ubl) domain located at the N-terminus of coronavirus SARS-CoV non-structural protein 3 (Nsp3) and related proteins; Region: Ubl1_cv_Nsp3_N-like; cl28922" /db_xref="CDD:475130" misc_feature 318..401 /gene="ubac1" /gene_synonym="kpc2; ubadc1" /note="propagated from UniProtKB/Swiss-Prot (Q28DG7.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 621..731 /gene="ubac1" /gene_synonym="kpc2; ubadc1" /note="UBA1 domain found in Kip1 ubiquitination-promoting complex protein 2 (KPC2) and similar proteins; Region: UBA1_KPC2; cd14303" /db_xref="CDD:270488" misc_feature 747..851 /gene="ubac1" /gene_synonym="kpc2; ubadc1" /note="propagated from UniProtKB/Swiss-Prot (Q28DG7.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 903..1019 /gene="ubac1" /gene_synonym="kpc2; ubadc1" /note="UBA2 domain found in Kip1 ubiquitination-promoting complex protein 2 (KPC2) and similar proteins; Region: UBA2_KPC2; cd14304" /db_xref="CDD:270489" misc_feature 1095..1214 /gene="ubac1" /gene_synonym="kpc2; ubadc1" /note="Heat shock chaperonin-binding motif; Region: STI1; smart00727" /db_xref="CDD:128966" ORIGIN
atgcccttggctcggtaggtagcggggagcgggacatgttcgtgcaggaggagaagatctttgcggggaaggggctccggctgcacatctgctccctggatggggccgagtggctggaggaggtcacggaggagatcacggtggagaagctgaaggagaagtgcctgaagcactgttcccacgggagcctggaggatccaaaaagcttaacccatcacaagctggtccatgcctcctctgagcgggttctctccgacaccaagacgctagcggaggagaatctccaagacaacgatgtcctcctgttggttaaaaaaagggcaccgccgccaacaccaaagatggccgaagtctctgctgacgagaagcggaagcaggatcagaaagcgccagacaaagacgccattctcaaggcaacggccggccttccagcccgcagcacggaccgcacggtggcgcaacataacatgagagacttccagactgagctcaggaagatactggtgtccctcattgaagttgcccagaagctgctggcgctgaaccctgatgcgattgagctgttcaagaaagccaatgccatgctggatgaggatgacgaggatcgggtagatgaagtcgcactgcggcagctgacggagatgggattcccggagagccgagccgtgaaagccctccgcttaaatcacatgtcggtgacgcaggccatggagtggttgatcgaacacgccgacgaccccgccgccgacgcgcctctcccatgtgagaattcctctgaggccgccgggggtttggccacgggggaagcggagacgaagccaactctgggggccggcgccgaggaccctaaggatgaactcacagaaatattcaagaaaattcgcaggaaaagagaattccgcccagaccctcgagccgtcattgcattaatggagatgggcttcgatgaaaaagaagtcattgatgcgctgcgagtgaacaacaaccaacaagacgccgcttgtgagtggctattgggtgacaggaagccatcgccggaggacttggacaaggggatcgatacgactagcccgttattccaagccattctggacaaccctgtagtacagctaggcctcactaaccccaaaactctgttagcttttgaagatatgctcgaaaacccgttaaacagcacccagtggatgaacgacccggagacgggccccgtgatgcttcagatctctagaattttccaaaccttaaaccgcacgtaggacacgtctcgtttttttttttcgtttacgccaacaccaacgagcttattgcctcttggacttttgggggaactcgaatatgacgggcaggtcggataccaaaatcccgcccccgtttaaggaggggccctaacccaaagtcaccttacaagaatatcaagggatatagattggcctaaaaccgcattgctgtttaaagggaaagtaaaacctgttttcggatactatttatgtgaatgaattgctttttttttttttctttttttgtgtgaatttcctttaggttggatggcactgaaatgtatttagggttaatagcagtgtgatttttcttttttgctttactaaaaccgcgctggacaagaccaccaaaatcgacttaaggtggtacagcaaccccccagcatgttgtgagcaagctgccggcttatgggtttgttaggaataggccccgtggcaacgtaaaaccagaatcagttatttattctaccgattttatatggttttaacccccagcgatgaataataagattttagttggccgcgctcccgccgggaacggcagattcttaatatttttagtttttatttggattattttgccgggacacattcaggaaaggttctattggggaaggcggcgtatgaatccgttctccttccttaccaatgcacaagtaccgagttcttcctcagaaagaaactttttacattctgcaactgcgccgaccttggtatggctactcccaagtgttctccctatgcgtgttacatggaaataaaacctctttatgcaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]