GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-04-19 10:37:32, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_001016712             838 bp    mRNA    linear   VRT 03-APR-2024
DEFINITION  Xenopus tropicalis HESX homeobox 1 (hesx1), mRNA.
ACCESSION   NM_001016712
VERSION     NM_001016712.2
KEYWORDS    RefSeq.
SOURCE      Xenopus tropicalis (tropical clawed frog)
  ORGANISM  Xenopus tropicalis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Silurana.
REFERENCE   1  (bases 1 to 838)
  AUTHORS   Fish,M.B., Nakayama,T., Fisher,M., Hirsch,N., Cox,A., Reeder,R.,
            Carruthers,S., Hall,A., Stemple,D.L. and Grainger,R.M.
  TITLE     Xenopus mutant reveals necessity of rax for specifying the eye
            field which otherwise forms tissue with telencephalic and
            diencephalic character
  JOURNAL   Dev Biol 395 (2), 317-330 (2014)
   PUBMED   25224223
  REMARK    GeneRIF: Knock-down of hesx1 and fezf2 show that failure to repress
            these two genes contributes to transformation of presumptive
            retinal tissue into non-retinal forebrain identities in the rax
            mutant.
REFERENCE   2  (bases 1 to 838)
  AUTHORS   Klein,S.L., Strausberg,R.L., Wagner,L., Pontius,J., Clifton,S.W.
            and Richardson,P.
  TITLE     Genetic and genomic tools for Xenopus research: The NIH Xenopus
            initiative
  JOURNAL   Dev Dyn 225 (4), 384-391 (2002)
   PUBMED   12454917
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CR760108.2.
            
            On Oct 14, 2005 this sequence version replaced NM_001016712.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC159020.1, CR760108.2 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           SAMD00028290, SAMD00028291
                                           [ECO:0000350]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..838
                     /organism="Xenopus tropicalis"
                     /mol_type="mRNA"
                     /db_xref="taxon:8364"
                     /chromosome="4"
                     /map="4"
     gene            1..838
                     /gene="hesx1"
                     /gene_synonym="anf2; hesx1-a; hesx1-b; rpx; Xanf; Xanf-1;
                     XANF-2; Xanf1; Xanf2"
                     /note="HESX homeobox 1"
                     /db_xref="GeneID:549466"
                     /db_xref="Xenbase:XB-GENE-483193"
     exon            1..173
                     /gene="hesx1"
                     /gene_synonym="anf2; hesx1-a; hesx1-b; rpx; Xanf; Xanf-1;
                     XANF-2; Xanf1; Xanf2"
                     /inference="alignment:Splign:2.1.0"
     CDS             14..574
                     /gene="hesx1"
                     /gene_synonym="anf2; hesx1-a; hesx1-b; rpx; Xanf; Xanf-1;
                     XANF-2; Xanf1; Xanf2"
                     /note="homeo box (expressed in ES cells) 1; homeobox
                     protein ANF-1"
                     /codon_start=1
                     /product="homeobox expressed in ES cells 1"
                     /protein_id="NP_001016712.1"
                     /db_xref="GeneID:549466"
                     /db_xref="Xenbase:XB-GENE-483193"
                     /translation="
MSPGLQKGSRLMENRSPPSSFSIEHILGLDKKTEVASSPIIKHHRPWIQCNSEGVDGTFWHIPVISCDLPVQVHALRRSMGEETQVRLEKCCGEEDRLTYKRELSWYRGRRPRTAFTRSQIEILENVFRVNSYPGIDIREELAGKLALDEDRIQIWFQNRRAKLKRSHRESQFLMVKDSLSSKIQE"
     misc_feature    341..511
                     /gene="hesx1"
                     /gene_synonym="anf2; hesx1-a; hesx1-b; rpx; Xanf; Xanf-1;
                     XANF-2; Xanf1; Xanf2"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            174..373
                     /gene="hesx1"
                     /gene_synonym="anf2; hesx1-a; hesx1-b; rpx; Xanf; Xanf-1;
                     XANF-2; Xanf1; Xanf2"
                     /inference="alignment:Splign:2.1.0"
     exon            374..475
                     /gene="hesx1"
                     /gene_synonym="anf2; hesx1-a; hesx1-b; rpx; Xanf; Xanf-1;
                     XANF-2; Xanf1; Xanf2"
                     /inference="alignment:Splign:2.1.0"
     exon            476..813
                     /gene="hesx1"
                     /gene_synonym="anf2; hesx1-a; hesx1-b; rpx; Xanf; Xanf-1;
                     XANF-2; Xanf1; Xanf2"
                     /inference="alignment:Splign:2.1.0"
     polyA_site      812
                     /gene="hesx1"
                     /gene_synonym="anf2; hesx1-a; hesx1-b; rpx; Xanf; Xanf-1;
                     XANF-2; Xanf1; Xanf2"
ORIGIN      
ctccagcggaaccatgtctcctggtcttcagaaaggatcccgtctgatggaaaacagatctccgccatcttccttttccatcgaacatatcttaggattagacaagaaaacggaggtggcatcgtcgcccattataaagcaccaccggccgtggatacagtgcaacagtgagggagtcgatggcaccttttggcacatcccagtgatcagctgtgatctccccgtgcaagttcacgccttgcgccgatcaatgggagaagagacccaggtcaggttggagaagtgttgtggggaagaggacagactgacctataagagagaactgagctggtaccgggggagaagacccagaacagctttcactagaagccagattgaaatactggagaatgtgttccgagtgaattcctatccgggcatcgacatcagggaagagctggccggcaaattagctctggatgaggatcggatccagatctggtttcaaaatcgccgggcaaaactcaaaaggtctcaccgggaatcccagttcctgatggttaaagactcgctgtcatccaagatacaagaatgagggtctgagtgtccctttgcccggctgggatattgttatatagcagtactgagtatgggcagaggggcccgggcacggcactacatggaccttggacctttccctgtatattttattctgcgtatttgtctagaagtccgagatatgtaaatattctgtaacataactctgaaacaataatgcactttctgtaaatagcctgtttttatgaattataataaatatttttaagaacttgaaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]