GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-09-13 19:59:15, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       NM_001016146            1387 bp    mRNA    linear   VRT 05-MAY-2025
DEFINITION  Xenopus tropicalis exoribonuclease 1 (eri1), mRNA.
ACCESSION   NM_001016146
VERSION     NM_001016146.2
KEYWORDS    RefSeq.
SOURCE      Xenopus tropicalis (tropical clawed frog)
  ORGANISM  Xenopus tropicalis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Silurana.
REFERENCE   1  (bases 1 to 1387)
  AUTHORS   Klein,S.L., Strausberg,R.L., Wagner,L., Pontius,J., Clifton,S.W.
            and Richardson,P.
  TITLE     Genetic and genomic tools for Xenopus research: The NIH Xenopus
            initiative
  JOURNAL   Dev Dyn 225 (4), 384-391 (2002)
   PUBMED   12454917
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CR761994.2.
            
            On Oct 14, 2005 this sequence version replaced NM_001016146.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: CR761994.2, BC155977.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00028305, SAMD00028306
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1387
                     /organism="Xenopus tropicalis"
                     /mol_type="mRNA"
                     /db_xref="taxon:8364"
                     /chromosome="1"
                     /map="1"
     gene            1..1387
                     /gene="eri1"
                     /gene_synonym="hexo; thex1"
                     /note="exoribonuclease 1"
                     /db_xref="GeneID:548900"
                     /db_xref="Xenbase:XB-GENE-974172"
     exon            1..160
                     /gene="eri1"
                     /gene_synonym="hexo; thex1"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    62..64
                     /gene="eri1"
                     /gene_synonym="hexo; thex1"
                     /note="upstream in-frame stop codon"
     CDS             71..1108
                     /gene="eri1"
                     /gene_synonym="hexo; thex1"
                     /EC_number="3.1.13.1"
                     /codon_start=1
                     /product="3'-5' exoribonuclease 1"
                     /protein_id="NP_001016146.1"
                     /db_xref="GeneID:548900"
                     /db_xref="Xenbase:XB-GENE-974172"
                     /translation="
MEEQKENRPLHTEDEDDLCRKLSKNLDFAGGKQRCRLDGQEDTGNSTISSHASDFSDPVYKEIAIANGCVNRMTKDELKAKLAEHKLDTRGVKDVLRKRLKNYYKKQKLRHALHKDSNTDCYYDYICVIDFEATCEEGNSTDYTHEIIEFPIVLLNTHTLEIEDVFQRYVRPEINPQLSEFCVNLTGITQDIVDKSDIFPDVLRSVVDWMREKELGTKYKYAILTDGSWDMSKFLNMQCRVSRLKYPRFAKKWINICKSYGNFYKVPRTQTKLTTMLEKLGMTYDGRLHSGVDDSKNIARIAAHMLQDGCELRVNERMHAGQLMTVSSSLPFEGAPVPQNPQLRN"
     misc_feature    278..382
                     /gene="eri1"
                     /gene_synonym="hexo; thex1"
                     /note="SAP domain; Region: SAP; pfam02037"
                     /db_xref="CDD:460424"
     misc_feature    446..988
                     /gene="eri1"
                     /gene_synonym="hexo; thex1"
                     /note="DEDDh 3'-5' exonuclease domain of Caenorhabditis
                     elegans ERI-1, human 3' exonuclease, and similar proteins;
                     Region: ERI-1_3'hExo_like; cd06133"
                     /db_xref="CDD:99836"
     misc_feature    order(458..469,473..475,611..613,746..760,770..772,
                     935..937,950..952)
                     /gene="eri1"
                     /gene_synonym="hexo; thex1"
                     /note="active site"
                     /db_xref="CDD:99836"
     misc_feature    order(458..469,473..475,611..613,746..760,770..772,
                     935..937,950..952)
                     /gene="eri1"
                     /gene_synonym="hexo; thex1"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:99836"
     misc_feature    order(458..460,464..466,758..760,935..937,950..952)
                     /gene="eri1"
                     /gene_synonym="hexo; thex1"
                     /note="catalytic site [active]"
                     /db_xref="CDD:99836"
     exon            161..339
                     /gene="eri1"
                     /gene_synonym="hexo; thex1"
                     /inference="alignment:Splign:2.1.0"
     exon            340..556
                     /gene="eri1"
                     /gene_synonym="hexo; thex1"
                     /inference="alignment:Splign:2.1.0"
     exon            557..640
                     /gene="eri1"
                     /gene_synonym="hexo; thex1"
                     /inference="alignment:Splign:2.1.0"
     exon            641..750
                     /gene="eri1"
                     /gene_synonym="hexo; thex1"
                     /inference="alignment:Splign:2.1.0"
     exon            751..865
                     /gene="eri1"
                     /gene_synonym="hexo; thex1"
                     /inference="alignment:Splign:2.1.0"
     exon            866..1364
                     /gene="eri1"
                     /gene_synonym="hexo; thex1"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1341..1346
                     /regulatory_class="polyA_signal_sequence"
                     /gene="eri1"
                     /gene_synonym="hexo; thex1"
     polyA_site      1363
                     /gene="eri1"
                     /gene_synonym="hexo; thex1"
ORIGIN      
aataggaagtgcagagtgagcgggattggggcagcgtggaaaggaaccttagggaacattctgacgagagatggaggagcagaaagaaaatcggccgctacacacggaggatgaggatgatttgtgcagaaagctctccaaaaacttggatttcgctggtggcaagcagaggtgtcgattggacggtcaggaggacactggaaattctacaatatcctcacatgctagtgacttcagtgatccagtttataaagaaattgccattgcaaatggttgtgtcaatagaatgactaaggatgagctgaaggcaaagcttgcagagcacaaacttgacactagaggtgttaaagatgtgctgaggaagagattgaagaattactacaagaagcagaaactgagacatgcattacataaggactcaaacacagactgctattatgattacatctgtgtcattgactttgaggcaacctgtgaagagggtaactctacagactacacccatgaaataatagagttccctatcgtcttactcaatacacacacactggaaattgaggatgtatttcagcgctacgtgagaccagaaattaatcctcaactttctgaattttgtgtcaaccttacaggtataactcaggatattgtagacaaatcagacatatttccagatgttcttcgtagtgttgtggactggatgcgtgaaaaggagcttggaacaaaatacaaatacgcgatacttactgatgggtcctgggatatgagcaagtttctaaacatgcagtgtcgtgttagtcgcctaaaataccctcgatttgcaaagaagtggatcaacatttgcaaatcttatgggaatttctacaaggtaccacggactcagacaaagttgaccaccatgctggaaaaattgggcatgacctatgatggacgtctgcacagtggcgtggatgattctaagaacattgctcgcattgcagctcatatgcttcaggatggctgcgagcttcgtgtaaatgagaggatgcatgcagggcagttaatgactgtgtctagctctttgccttttgaaggggctccagttcctcaaaatccacagctgagaaattagtattttatgtctctgtaaatacatcgttttgaagagttttttaggagcaccttaaaatatcattttatatatattgtaattcttatcttgaacgaaataaacttaaactgcggcagaatggttttaaatgtttgctttagcactttaacatttgaaaaagaaaatgtattgctttcttgaaatattttaaaaagtgaactgtattattggtttgatcaataaataagctgagaataaaaatccttgcttaacttcaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]