2025-04-19 09:57:20, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001011476 1014 bp mRNA linear VRT 11-FEB-2025 DEFINITION Xenopus tropicalis selenoprotein S (selenos), mRNA. ACCESSION NM_001011476 VERSION NM_001011476.2 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana. REFERENCE 1 (bases 1 to 1014) AUTHORS Gladyshev,V.N., Arner,E.S., Berry,M.J., Brigelius-Flohe,R., Bruford,E.A., Burk,R.F., Carlson,B.A., Castellano,S., Chavatte,L., Conrad,M., Copeland,P.R., Diamond,A.M., Driscoll,D.M., Ferreiro,A., Flohe,L., Green,F.R., Guigo,R., Handy,D.E., Hatfield,D.L., Hesketh,J., Hoffmann,P.R., Holmgren,A., Hondal,R.J., Howard,M.T., Huang,K., Kim,H.Y., Kim,I.Y., Kohrle,J., Krol,A., Kryukov,G.V., Lee,B.J., Lee,B.C., Lei,X.G., Liu,Q., Lescure,A., Lobanov,A.V., Loscalzo,J., Maiorino,M., Mariotti,M., Sandeep Prabhu,K., Rayman,M.P., Rozovsky,S., Salinas,G., Schmidt,E.E., Schomburg,L., Schweizer,U., Simonovic,M., Sunde,R.A., Tsuji,P.A., Tweedie,S., Ursini,F., Whanger,P.D. and Zhang,Y. TITLE Selenoprotein Gene Nomenclature JOURNAL J Biol Chem 291 (46), 24036-24040 (2016) PUBMED 27645994 REFERENCE 2 (bases 1 to 1014) AUTHORS Bubenik,J.L., Miniard,A.C. and Driscoll,D.M. TITLE Alternative transcripts and 3'UTR elements govern the incorporation of selenocysteine into selenoprotein S JOURNAL PLoS One 8 (4), e62102 (2013) PUBMED 23614019 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1014) AUTHORS Mariotti,M., Ridge,P.G., Zhang,Y., Lobanov,A.V., Pringle,T.H., Guigo,R., Hatfield,D.L. and Gladyshev,V.N. TITLE Composition and evolution of the vertebrate and mammalian selenoproteomes JOURNAL PLoS One 7 (3), e33066 (2012) PUBMED 22479358 REFERENCE 4 (bases 1 to 1014) AUTHORS Klein,S.L., Strausberg,R.L., Wagner,L., Pontius,J., Clifton,S.W. and Richardson,P. TITLE Genetic and genomic tools for Xenopus research: The NIH Xenopus initiative JOURNAL Dev Dyn 225 (4), 384-391 (2002) PUBMED 12454917 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from EL837085.1 and BC088768.1. On Jan 23, 2017 this sequence version replaced NM_001011476.1. Summary: This gene encodes a transmembrane protein that is localized in the endoplasmic reticulum (ER). It is involved in the degradation process of misfolded proteins in the ER, and may also have a role in inflammation control. This protein is a selenoprotein, containing the rare amino acid selenocysteine (Sec). Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Two additional stem-loop structures in the 3' UTR of this mRNA have been shown to function as modulators of Sec insertion (PMID:23614019). [provided by RefSeq, Jul 2017]. ##Evidence-Data-START## Transcript exon combination :: CR760118.2, DN095406.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00862014, SAMN00862016 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## protein contains selenocysteine :: inferred from conservation ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-31 EL837085.1 12-42 32-1014 BC088768.1 1-983 FEATURES Location/Qualifiers source 1..1014 /organism="Xenopus tropicalis" /mol_type="mRNA" /db_xref="taxon:8364" /chromosome="3" /map="3" gene 1..1014 /gene="selenos" /gene_synonym="AD-015; ADO15; SBBI8; sels; seps1; vimp" /note="selenoprotein S" /db_xref="GeneID:496967" /db_xref="Xenbase:XB-GENE-1007235" exon 1..127 /gene="selenos" /gene_synonym="AD-015; ADO15; SBBI8; sels; seps1; vimp" /inference="alignment:Splign:2.1.0" CDS 49..618 /gene="selenos" /gene_synonym="AD-015; ADO15; SBBI8; sels; seps1; vimp" /note="UGA stop codon recoded as selenocysteine; VCP-interacting membrane protein; VCP-interacting membrane selenoprotein" /codon_start=1 /transl_except=(pos:610..612,aa:Sec) /product="selenoprotein S" /protein_id="NP_001011476.2" /db_xref="GeneID:496967" /db_xref="Xenbase:XB-GENE-1007235" /translation="
MELGNQPGPGNRPEIELEWYQYLQNTVGVVLSSYGWYILLGCILIYLLIQKLPQNFTRAGTSNHSTVTDPDEIVRRQEAVTAARLRMQEELNAQAELYKQKQVQLQEEKRQRNIETWDRMKEGKSSKVACRLGQEPSPSTSTSAATKPKQEKQERKTLRGSGYNPLTGDGGGTCAWRPGRRGPSSGGUG"
misc_feature 49..609 /gene="selenos" /gene_synonym="AD-015; ADO15; SBBI8; sels; seps1; vimp" /note="Selenoprotein S (SelS); Region: Selenoprotein_S; pfam06936" /db_xref="CDD:462043" misc_feature 133..195 /gene="selenos" /gene_synonym="AD-015; ADO15; SBBI8; sels; seps1; vimp" /note="propagated from UniProtKB/Swiss-Prot (Q5I030.2); transmembrane region" misc_feature 388..615 /gene="selenos" /gene_synonym="AD-015; ADO15; SBBI8; sels; seps1; vimp" /note="propagated from UniProtKB/Swiss-Prot (Q5I030.2); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 610..612 /gene="selenos" /gene_synonym="AD-015; ADO15; SBBI8; sels; seps1; vimp" /note="Selenocysteine; other site" exon 128..253 /gene="selenos" /gene_synonym="AD-015; ADO15; SBBI8; sels; seps1; vimp" /inference="alignment:Splign:2.1.0" exon 254..360 /gene="selenos" /gene_synonym="AD-015; ADO15; SBBI8; sels; seps1; vimp" /inference="alignment:Splign:2.1.0" exon 361..450 /gene="selenos" /gene_synonym="AD-015; ADO15; SBBI8; sels; seps1; vimp" /inference="alignment:Splign:2.1.0" exon 451..532 /gene="selenos" /gene_synonym="AD-015; ADO15; SBBI8; sels; seps1; vimp" /inference="alignment:Splign:2.1.0" exon 533..996 /gene="selenos" /gene_synonym="AD-015; ADO15; SBBI8; sels; seps1; vimp" /inference="alignment:Splign:2.1.0" regulatory 859..934 /regulatory_class="recoding_stimulatory_region" /gene="selenos" /gene_synonym="AD-015; ADO15; SBBI8; sels; seps1; vimp" /note="SECIS_element" /function="essential for recoding UGA to specify selenocysteine" polyA_site 996 /gene="selenos" /gene_synonym="AD-015; ADO15; SBBI8; sels; seps1; vimp" ORIGIN
gcgagaataaacacacaaaccggatctaaccctattcggcctgttaacatggagctgggaaaccagccggggccggggaatcgccccgaaatcgagctggagtggtaccagtatcttcagaatacagtgggtgtggtcctgtcaagctatggatggtacatcttactcggctgcatccttatatatctcttgattcagaagttgccacagaatttcacacgagccggcacatcgaatcacagcacggtgacagatcctgatgagattgtcagaagacaagaagcagtgacagccgcccggcttcggatgcaggaggagctcaatgctcaggctgaattatacaaacagaagcaggttcagttgcaagaggaaaagcgtcagcgaaacatagagacctgggatcgtatgaaagaaggcaagagttccaaggtggcctgccgtcttggccaggaaccatctcctagcacctccacatcagctgccacaaagcccaaacaagaaaagcaagaaaggaaaacattgcgtggcagcgggtacaatcctctgaccggagatggaggtggtacatgtgcctggcgaccaggacgaagaggtccttcttcaggaggatgaggttaagcctcttgctggtatttttccccttgggaatatcagcaaggttaaaagaatgcaccacctgcagtaatagtgtcgattccaatggccctcagtcagcgacccattaggaacagagcttggatgaacgtttctggtcacactttctctgtgagttatggaagaagtcacttgatgaatgttaaggagctcttgagaagaagaagctggaatactatctgatcagatcaggccggggaactgcaatctgacactctgcatgatgtcctccttacaaatggcacaatagccaatgaggatgactgatgttgttaggtggtatgcactctgtatatgctcttttctttgtgtctgctgctttaatagatgctttgcaccacaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]