GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-04-19 06:54:47, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_001021430            1006 bp    mRNA    linear   PLN 16-AUG-2024
DEFINITION  Schizosaccharomyces pombe DNA polymerase epsilon subunit Dpb4
            (dpb4), mRNA.
ACCESSION   NM_001021430
VERSION     NM_001021430.3
DBLINK      BioProject: PRJNA127
            BioSample: SAMEA3138176
KEYWORDS    RefSeq.
SOURCE      Schizosaccharomyces pombe (fission yeast)
  ORGANISM  Schizosaccharomyces pombe
            Eukaryota; Fungi; Dikarya; Ascomycota; Taphrinomycotina;
            Schizosaccharomycetes; Schizosaccharomycetales;
            Schizosaccharomycetaceae; Schizosaccharomyces.
REFERENCE   1  (bases 1 to 1006)
  AUTHORS   Schafer,B., Hansen,M. and Lang,B.F.
  TITLE     Transcription and RNA-processing in fission yeast mitochondria
  JOURNAL   RNA 11 (5), 785-795 (2005)
   PUBMED   15811919
REFERENCE   2  (bases 1 to 1006)
  AUTHORS   Wood,V., Gwilliam,R., Rajandream,M.A., Lyne,M., Lyne,R.,
            Stewart,A., Sgouros,J., Peat,N., Hayles,J., Baker,S., Basham,D.,
            Bowman,S., Brooks,K., Brown,D., Brown,S., Chillingworth,T.,
            Churcher,C., Collins,M., Connor,R., Cronin,A., Davis,P.,
            Feltwell,T., Fraser,A., Gentles,S., Goble,A., Hamlin,N., Harris,D.,
            Hidalgo,J., Hodgson,G., Holroyd,S., Hornsby,T., Howarth,S.,
            Huckle,E.J., Hunt,S., Jagels,K., James,K., Jones,L., Jones,M.,
            Leather,S., McDonald,S., McLean,J., Mooney,P., Moule,S.,
            Mungall,K., Murphy,L., Niblett,D., Odell,C., Oliver,K., O'Neil,S.,
            Pearson,D., Quail,M.A., Rabbinowitsch,E., Rutherford,K., Rutter,S.,
            Saunders,D., Seeger,K., Sharp,S., Skelton,J., Simmonds,M.,
            Squares,R., Squares,S., Stevens,K., Taylor,K., Taylor,R.G.,
            Tivey,A., Walsh,S., Warren,T., Whitehead,S., Woodward,J.,
            Volckaert,G., Aert,R., Robben,J., Grymonprez,B., Weltjens,I.,
            Vanstreels,E., Rieger,M., Schafer,M., Muller-Auer,S., Gabel,C.,
            Fuchs,M., Dusterhoft,A., Fritzc,C., Holzer,E., Moestl,D.,
            Hilbert,H., Borzym,K., Langer,I., Beck,A., Lehrach,H.,
            Reinhardt,R., Pohl,T.M., Eger,P., Zimmermann,W., Wedler,H.,
            Wambutt,R., Purnelle,B., Goffeau,A., Cadieu,E., Dreano,S.,
            Gloux,S., Lelaure,V., Mottier,S., Galibert,F., Aves,S.J., Xiang,Z.,
            Hunt,C., Moore,K., Hurst,S.M., Lucas,M., Rochet,M., Gaillardin,C.,
            Tallada,V.A., Garzon,A., Thode,G., Daga,R.R., Cruzado,L.,
            Jimenez,J., Sanchez,M., del Rey,F., Benito,J., Dominguez,A.,
            Revuelta,J.L., Moreno,S., Armstrong,J., Forsburg,S.L., Cerutti,L.,
            Lowe,T., McCombie,W.R., Paulsen,I., Potashkin,J., Shpakovski,G.V.,
            Ussery,D., Barrell,B.G. and Nurse,P.
  TITLE     The genome sequence of Schizosaccharomyces pombe
  JOURNAL   Nature 415 (6874), 871-880 (2002)
   PUBMED   11859360
  REMARK    Erratum:[Nature 2003 Jan 2;421(6918):94. Cerrutti L [corrected to
            Cerutti L]]
REFERENCE   3
  AUTHORS   Wood,V., Gwilliam,R., Rajandream,M.A., Lyne,M., Lyne,R.,
            Stewart,A., Sgouros,J., Peat,N., Hayles,J., Baker,S., Basham,D.,
            Bowman,S., Brooks,K., Brown,D., Brown,S., Chillingworth,T.,
            Churcher,C., Collins,M., Connor,R., Cronin,A., Davis,P.,
            Feltwell,T., Fraser,A., Gentles,S., Goble,A., Hamlin,N., Harris,D.,
            Hidalgo,J., Hodgson,G., Holroyd,S., Hornsby,T., Howarth,S.,
            Huckle,E.J., Hunt,S., Jagels,K., James,K., Jones,L., Jones,M.,
            Leather,S., McDonald,S., McLean,J., Mooney,P., Moule,S.,
            Mungall,K., Murphy,L., Niblett,D., Odell,C., Oliver,K., O'Neil,S.,
            Pearson,D., Quail,M.A., Rabbinowitsch,E., Rutherford,K., Rutter,S.,
            Saunders,D., Seeger,K., Sharp,S., Skelton,J., Simmonds,M.,
            Squares,R., Squares,S., Stevens,K., Taylor,K., Taylor,R.G.,
            Tivey,A., Walsh,S., Warren,T., Whitehead,S., Woodward,J.,
            Volckaert,G., Aert,R., Robben,J., Grymonprez,B., Weltjens,I.,
            Vanstreels,E., Rieger,M., Schafer,M., Muller-Auer,S., Gabel,C.,
            Fuchs,M., Dusterhoft,A., Fritzc,C., Holzer,E., Moestl,D.,
            Hilbert,H., Borzym,K., Langer,I., Beck,A., Lehrach,H.,
            Reinhardt,R., Pohl,T.M., Eger,P., Zimmermann,W., Wedler,H.,
            Wambutt,R., Purnelle,B., Goffeau,A., Cadieu,E., Dreano,S.,
            Gloux,S., Lelaure,V., Mottier,S., Galibert,F., Aves,S.J., Xiang,Z.,
            Hunt,C., Moore,K., Hurst,S.M., Lucas,M., Rochet,M., Gaillardin,C.,
            Tallada,V.A., Garzon,A., Thode,G., Daga,R.R., Cruzado,L.,
            Jimenez,J., Sanchez,M., del Rey,F., Benito,J., Dominguez,A.,
            Revuelta,J.L., Moreno,S., Armstrong,J., Forsburg,S.L., Cerutti,L.,
            Lowe,T., McCombie,W.R., Paulsen,I., Potashkin,J., Shpakovski,G.V.,
            Ussery,D., Barrell,B.G. and Nurse,P.
  TITLE     The genome sequence of Schizosaccharomyces pombe
  JOURNAL   Nature 415 (6874), 871-880 (2002)
   PUBMED   11859360
  REMARK    Erratum:[Nature 2003 Jan 2;421(6918):94. Cerrutti L [corrected to
            Cerutti L]]
REFERENCE   4  (bases 1 to 1006)
  AUTHORS   Trinkl,H., Lang,B.F. and Wolf,K.
  TITLE     Nucleotide sequence of the gene encoding the small ribosomal RNA in
            the mitochondrial genome of the fission yeast Schizosaccharomyces
            pombe
  JOURNAL   Nucleic Acids Res 17 (16), 6730 (1989)
   PUBMED   2780299
REFERENCE   5  (bases 1 to 1006)
  AUTHORS   Lang,B.F., Cedergren,R. and Gray,M.W.
  TITLE     The mitochondrial genome of the fission yeast, Schizosaccharomyces
            pombe. Sequence of the large-subunit ribosomal RNA gene, comparison
            of potential secondary structure in fungal mitochondrial
            large-subunit rRNAs and evolutionary considerations
  JOURNAL   Eur J Biochem 169 (3), 527-537 (1987)
   PUBMED   2446871
REFERENCE   6  (bases 1 to 1006)
  AUTHORS   Lang,B.F., Ahne,F. and Bonen,L.
  TITLE     The mitochondrial genome of the fission yeast Schizosaccharomyces
            pombe. The cytochrome b gene has an intron closely related to the
            first two introns in the Saccharomyces cerevisiae cox1 gene
  JOURNAL   J Mol Biol 184 (3), 353-366 (1985)
   PUBMED   4046021
REFERENCE   7  (bases 1 to 1006)
  AUTHORS   Lang,B.F.
  TITLE     The mitochondrial genome of the fission yeast Schizosaccharomyces
            pombe: highly homologous introns are inserted at the same position
            of the otherwise less conserved cox1 genes in Schizosaccharomyces
            pombe and Aspergillus nidulans
  JOURNAL   EMBO J 3 (9), 2129-2136 (1984)
   PUBMED   6092057
REFERENCE   8  (bases 1 to 1006)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (16-AUG-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   9
  AUTHORS   Wood,V. and Rutherford,K.
  CONSRTM   PomBase
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAR-2024) University of Cambridge, PomBase, Hopkins
            building, Tennis Court Rd, Cambridge, United Kingdom
REFERENCE   10
  AUTHORS   Wood,V.
  CONSRTM   The Schizosaccharomyces pombe Genome Sequencing Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (29-JUN-2007) European Schizosaccharomyces genome
            sequencing project, Sanger Institute, The Wellcome Trust Genome
            Campus, Hinxton, Cambridge CB10 1SA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_003423).
            
            On Jun 21, 2024 this sequence version replaced NM_001021430.2.
FEATURES             Location/Qualifiers
     source          1..1006
                     /organism="Schizosaccharomyces pombe"
                     /mol_type="mRNA"
                     /strain="972h-"
                     /db_xref="taxon:4896"
                     /chromosome="II"
     gene            1..1006
                     /gene="dpb4"
                     /locus_tag="SPOM_SPBC3D6.09"
                     /db_xref="GeneID:2540966"
                     /db_xref="PomBase:SPBC3D6.09"
     CDS             198..830
                     /gene="dpb4"
                     /locus_tag="SPOM_SPBC3D6.09"
                     /codon_start=1
                     /product="DNA polymerase epsilon subunit Dpb4"
                     /protein_id="NP_595521.1"
                     /db_xref="GeneID:2540966"
                     /db_xref="PomBase:SPBC3D6.09"
                     /translation="
MNQDKSKETSELDDLALPRSIIMRLVKGVLPEKSLVQKEALKAMINSATLFVSFLTSASGEIATNNNRKILMPQDVLNALDEIEYPEFSKTLKKHLEAYELALKEKRLKLPNVSDVDNRKKAKIDAHDTTPLDEEKDELEEERIAEDIAQNEVEQNIDDVEDLEEVNDTLDANAESPQIETIHLTDATGNPIEDSSESDSEESLQLNDSS"
     misc_feature    234..494
                     /gene="dpb4"
                     /locus_tag="SPOM_SPBC3D6.09"
                     /note="histone-fold domain found in DNA polymerase epsilon
                     subunit 3 (POLE3) and similar proteins; Region:
                     HFD_POLE3_DPB4; cd22928"
                     /db_xref="CDD:467053"
     misc_feature    order(234..239,333..335,345..347,354..359,366..371,
                     414..419,441..443,456..458,474..479,486..488)
                     /gene="dpb4"
                     /locus_tag="SPOM_SPBC3D6.09"
                     /note="catalytic subunit binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:467053"
     misc_feature    order(258..260,270..275,279..281,303..308,312..317,
                     324..329,333..341,345..365,402..416,423..425,444..452,
                     459..461,468..473,480..485,489..494)
                     /gene="dpb4"
                     /locus_tag="SPOM_SPBC3D6.09"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467053"
ORIGIN      
ataacgcacagatagtgtttagtgaaaattgacagaaataggcgactcagtgaatttattatacattaattagctaaaaagaagcaaccgcctttctctgtgattatcgtttggtgaccataggatgatatttggattggatttataaaagacttgtatacagcgtttgtaaaagatctagcggctggaaaatcaatatgaatcaagataaatcgaaagaaacttccgaattggatgatctggcgcttcctcgatcgatcattatgcgattagtcaaaggtgtcttacctgaaaagagtcttgtacaaaaagaagctctcaaggctatgatcaattcagcaactctttttgttagttttctaacatccgcttctggggaaattgctacgaataataacagaaaaattcttatgcctcaagacgttttgaatgcgctcgatgaaattgagtatccagaattctctaaaacgttaaaaaaacatctcgaagcatatgagcttgccttgaaagaaaaacgattgaaactccctaacgtatcagatgttgataacagaaagaaagccaaaatagacgcgcatgacactactcctctagatgaagaaaaagacgaattagaagaagaacgaattgcggaggatatagcacaaaatgaagttgagcaaaatattgatgatgtggaggacctcgaagaagtgaatgatacattagacgcaaacgcagaatctcctcaaatagaaaccattcatcttacagatgctacgggaaacccaattgaagatagctctgaatccgactcagaagaatctcttcaacttaatgattcttcgtaattactgttggttaaatgtatatgaagattgtcaatagtcctaacttacatggagagctaatcatatttttttacacgaaaaactaaaccttctttattttttaatggattttttggatacctgttaataccccaatttacatccttgtatccaaacatagcttttttaaacagcag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]