2025-04-20 02:45:55, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001180837 384 bp mRNA linear PLN 17-DEC-2024 DEFINITION Saccharomyces cerevisiae S288C ubiquinol--cytochrome-c reductase subunit 7 (QCR7), partial mRNA. ACCESSION NM_001180837 VERSION NM_001180837.1 DBLINK BioProject: PRJNA128 KEYWORDS RefSeq. SOURCE Saccharomyces cerevisiae S288C ORGANISM Saccharomyces cerevisiae S288C Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. REFERENCE 1 (bases 1 to 384) AUTHORS Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M., Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S., Weng,S. and Cherry,J.M. TITLE New data and collaborations at the Saccharomyces Genome Database: updated reference genome, alleles, and the Alliance of Genome Resources JOURNAL Genetics 220 (4) (2022) PUBMED 34897464 REFERENCE 2 (bases 1 to 384) AUTHORS Jacq,C., Alt-Morbe,J., Andre,B., Arnold,W., Bahr,A., Ballesta,J.P., Bargues,M., Baron,L., Becker,A., Biteau,N., Blocker,H., Blugeon,C., Boskovic,J., Brandt,P., Bruckner,M., Buitrago,M.J., Coster,F., Delaveau,T., del Rey,F., Dujon,B., Eide,L.G., Garcia-Cantalejo,J.M., Goffeau,A., Gomez-Peris,A., Zaccaria,P. et al. TITLE The nucleotide sequence of Saccharomyces cerevisiae chromosome IV JOURNAL Nature 387 (6632 SUPPL), 75-78 (1997) PUBMED 9169867 REFERENCE 3 (bases 1 to 384) AUTHORS Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B., Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M., Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and Oliver,S.G. TITLE Life with 6000 genes JOURNAL Science 274 (5287), 546 (1996) PUBMED 8849441 REFERENCE 4 (bases 1 to 384) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (17-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 384) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (16-JAN-2015) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Protein update by submitter REFERENCE 6 (bases 1 to 384) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (06-FEB-2013) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Protein update by submitter REFERENCE 7 (bases 1 to 384) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (04-MAY-2012) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Protein update by submitter REFERENCE 8 (bases 1 to 384) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (31-MAR-2011) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Sequence update by submitter REFERENCE 9 (bases 1 to 384) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (11-DEC-2009) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA COMMENT REVIEWED REFSEQ: This record has been curated by SGD. This record is derived from an annotated genomic sequence (NC_001136). ##Genome-Annotation-Data-START## Annotation Provider :: SGD Annotation Status :: Full Annotation Annotation Version :: R64-4-1 URL :: http://www.yeastgenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..384 /organism="Saccharomyces cerevisiae S288C" /mol_type="mRNA" /strain="S288C" /db_xref="taxon:559292" /chromosome="IV" gene <1..>384 /gene="QCR7" /locus_tag="YDR529C" /gene_synonym="COR4; CRO1; UCR7" /db_xref="GeneID:852142" CDS 1..384 /gene="QCR7" /locus_tag="YDR529C" /gene_synonym="COR4; CRO1; UCR7" /experiment="EXISTENCE:direct assay:GO:0005739 mitochondrion [PMID:24769239|PMID:16823961]" /experiment="EXISTENCE:direct assay:GO:0045275 respiratory chain complex III [PMID:10873857]" /experiment="EXISTENCE:mutant phenotype:GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c [PMID:2540976]" /experiment="EXISTENCE:mutant phenotype:GO:0008121 ubiquinol-cytochrome-c reductase activity [PMID:2540976]" /experiment="EXISTENCE:mutant phenotype:GO:0009060 aerobic respiration [PMID:2540976]" /experiment="EXISTENCE:mutant phenotype:GO:0034551 mitochondrial respiratory chain complex III assembly [PMID:11556808]" /note="Subunit 7 of ubiquinol cytochrome-c reductase (Complex III); Complex III is a component of the mitochondrial inner membrane electron transport chain; oriented facing the mitochondrial matrix; N-terminus appears to play a role in complex assembly" /codon_start=1 /product="ubiquinol--cytochrome-c reductase subunit 7" /protein_id="NP_010818.1" /db_xref="GeneID:852142" /db_xref="SGD:S000002937" /translation="
MPQSFTSIARIGDYILKSPVLSKLCVPVANQFINLAGYKKLGLKFDDLIAEENPIMQTALRRLPEDESYARAYRIIRAHQTELTHHLLPRNEWIKAQEDVPYLLPYILEAEAAAKEKDELDNIEVSK"
misc_feature 55..354 /gene="QCR7" /locus_tag="YDR529C" /gene_synonym="COR4; CRO1; UCR7" /note="Ubiquinol-cytochrome C reductase complex 14kD subunit; Region: UCR_14kD; pfam02271" /db_xref="CDD:460519" ORIGIN
atgccacagtcttttacgtctattgcgagaattggtgactatattttgaagtcacccgtcctctccaagttatgtgttccagttgccaatcagttcattaacctcgcaggttacaagaagttagggctcaaatttgacgacttaattgcagaggaaaatcccatcatgcagaccgctttaagaagactccctgaagatgaatcttatgccagagcatatagaataatcagggctcatcaaaccgagttgactcatcatttactgccaagaaacgaatggatcaaagcccaagaggatgttccttacctgttgccatacatattagaagctgaagctgcagctaaggagaaggacgagttagacaacatagaggtctccaaatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]