2025-04-20 02:50:25, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001179708 660 bp mRNA linear PLN 17-DEC-2024 DEFINITION Saccharomyces cerevisiae S288C Mrp8p (MRP8), partial mRNA. ACCESSION NM_001179708 VERSION NM_001179708.1 DBLINK BioProject: PRJNA128 KEYWORDS RefSeq. SOURCE Saccharomyces cerevisiae S288C ORGANISM Saccharomyces cerevisiae S288C Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. REFERENCE 1 (bases 1 to 660) AUTHORS Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M., Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S., Weng,S. and Cherry,J.M. TITLE New data and collaborations at the Saccharomyces Genome Database: updated reference genome, alleles, and the Alliance of Genome Resources JOURNAL Genetics 220 (4) (2022) PUBMED 34897464 REFERENCE 2 (bases 1 to 660) AUTHORS Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B., Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M., Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and Oliver,S.G. TITLE Life with 6000 genes JOURNAL Science 274 (5287), 546 (1996) PUBMED 8849441 REFERENCE 3 (bases 1 to 660) AUTHORS Dujon,B., Alexandraki,D., Andre,B., Ansorge,W., Baladron,V., Ballesta,J.P., Banrevi,A., Bolle,P.A., Bolotin-Fukuhara,M., Bossier,P. et al. TITLE Complete DNA sequence of yeast chromosome XI JOURNAL Nature 369 (6479), 371-378 (1994) PUBMED 8196765 REFERENCE 4 (bases 1 to 660) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (17-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 660) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (04-MAY-2012) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Protein update by submitter REFERENCE 6 (bases 1 to 660) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (31-MAR-2011) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Sequence update by submitter REFERENCE 7 (bases 1 to 660) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (14-DEC-2009) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA COMMENT REVIEWED REFSEQ: This record has been curated by SGD. This record is derived from an annotated genomic sequence (NC_001143). ##Genome-Annotation-Data-START## Annotation Provider :: SGD Annotation Status :: Full Annotation Annotation Version :: R64-4-1 URL :: http://www.yeastgenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..660 /organism="Saccharomyces cerevisiae S288C" /mol_type="mRNA" /strain="S288C" /db_xref="taxon:559292" /chromosome="XI" gene <1..>660 /gene="MRP8" /locus_tag="YKL142W" /gene_synonym="YKL3" /db_xref="GeneID:853715" CDS 1..660 /gene="MRP8" /locus_tag="YKL142W" /gene_synonym="YKL3" /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm [PMID:14562095]" /note="hypothetical protein; undergoes sumoylation; transcription induced under cell wall stress; protein levels are reduced under anaerobic conditions; protein abundance increases in response to DNA replication stress; originally thought to be a mitochondrial ribosomal protein based on sequence analysis" /codon_start=1 /product="Mrp8p" /protein_id="NP_012780.1" /db_xref="GeneID:853715" /db_xref="SGD:S000001625" /translation="
MSNEIELLQKQVSELQDLVKKQSLIISKTGERVLELQLDKQKHDVTDFDSKFSKSISKKSGSATQFDATDFATNEDLVELVKELQGELNFIEERSIRRLVNSLKKDDDDVIAPLPNADGDIPAISDGVFPKSLKEFKDIPDLKLVRLAKFYERLPPTLKEQEDFENFLEGKVEAFHINETTDEEISKELEKFSKDELDDAFNDVARYLGLSLRRGTEIW"
misc_feature 1..657 /gene="MRP8" /locus_tag="YKL142W" /gene_synonym="YKL3" /note="Protein of unknown function (DUF3294); Region: DUF3294; pfam07957" /db_xref="CDD:400351" ORIGIN
atgtctaacgaaattgaattactgcagaagcaagtctctgaattacaagacttagtgaagaagcaaagtctgattatctctaagacaggagagcgtgtgctggaattgcagttagataaacaaaagcacgacgtaactgattttgattcgaaattctctaaatctatctcgaagaaatcaggatccgctactcaattcgatgccactgattttgccacaaatgaagatctagtggaattagtcaaagaactacagggtgagctaaatttcatcgaggaaaggtctatcagaagacttgttaactctttgaaaaaagatgatgatgacgttatagcgccactgcctaatgcagatggtgatattcctgctatttcagacggagtgttccctaagtcgttgaaagaatttaaagacatcccagacttaaaactggtaagacttgctaaattctacgaaagattgccaccaactctaaaggaacaagaagattttgaaaacttcctggaaggtaaggtggaagcctttcacattaatgagaccactgatgaagagatttctaaggagttggaaaagttctccaaagatgagctagatgatgcatttaatgatgttgcccgctatctaggtctctcccttagaagaggaaccgaaatatggtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]