2025-04-19 10:49:41, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001178804 381 bp mRNA linear PLN 17-DEC-2024 DEFINITION Saccharomyces cerevisiae S288C Hmra1p (HMRA1), partial mRNA. ACCESSION NM_001178804 VERSION NM_001178804.1 DBLINK BioProject: PRJNA128 KEYWORDS RefSeq. SOURCE Saccharomyces cerevisiae S288C ORGANISM Saccharomyces cerevisiae S288C Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. REFERENCE 1 (bases 1 to 381) AUTHORS Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M., Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S., Weng,S. and Cherry,J.M. TITLE New data and collaborations at the Saccharomyces Genome Database: updated reference genome, alleles, and the Alliance of Genome Resources JOURNAL Genetics 220 (4) (2022) PUBMED 34897464 REFERENCE 2 (bases 1 to 381) AUTHORS Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B., Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M., Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and Oliver,S.G. TITLE Life with 6000 genes JOURNAL Science 274 (5287), 546 (1996) PUBMED 8849441 REFERENCE 3 (bases 1 to 381) AUTHORS Oliver,S.G., van der Aart,Q.J., Agostoni-Carbone,M.L., Aigle,M., Alberghina,L., Alexandraki,D., Antoine,G., Anwar,R., Ballesta,J.P., Benit,P. et al. TITLE The complete DNA sequence of yeast chromosome III JOURNAL Nature 357 (6373), 38-46 (1992) PUBMED 1574125 REFERENCE 4 (bases 1 to 381) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (17-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 381) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (16-JAN-2015) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Protein update by submitter REFERENCE 6 (bases 1 to 381) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (12-APR-2011) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Sequence update by submitter REFERENCE 7 (bases 1 to 381) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (27-MAY-2010) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Protein update by submitter REFERENCE 8 (bases 1 to 381) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (21-MAY-2010) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Protein update by submitter REFERENCE 9 (bases 1 to 381) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (11-DEC-2009) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA COMMENT REVIEWED REFSEQ: This record has been curated by SGD. This record is derived from an annotated genomic sequence (NC_001135). ##Genome-Annotation-Data-START## Annotation Provider :: SGD Annotation Status :: Full Annotation Annotation Version :: R64-4-1 URL :: http://www.yeastgenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..381 /organism="Saccharomyces cerevisiae S288C" /mol_type="mRNA" /strain="S288C" /db_xref="taxon:559292" /chromosome="III" gene <1..>381 /gene="HMRA1" /locus_tag="YCR097W" /gene_synonym="YCR097WB" /db_xref="GeneID:850459" CDS 1..381 /gene="HMRA1" /locus_tag="YCR097W" /gene_synonym="YCR097WB" /experiment="EXISTENCE:direct assay:GO:0003714 transcription corepressor activity [PMID:1977088]" /experiment="EXISTENCE:direct assay:GO:0005634 nucleus [PMID:8411150]" /experiment="EXISTENCE:direct assay:GO:0007532 regulation of mating-type specific transcription, DNA-templated [PMID:1977088]" /note="Silenced copy of a1 at HMR; homeobox corepressor that interacts with Alpha2p to repress haploid-specific gene transcription in diploid cells" /codon_start=1 /product="Hmra1p" /protein_id="NP_010021.1" /db_xref="GeneID:850459" /db_xref="SGD:S000000694" /translation="
MDDICSMAENINRTLFNILGTEIDEINLNTNNLYNFIMESNLTKVEQHTLHKNISNNRLEIYHHIKKEKSPKGKSSISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK"
misc_feature 208..378 /gene="HMRA1" /locus_tag="YCR097W" /gene_synonym="YCR097WB" /note="Homeodomain; Region: HOX; smart00389" /db_xref="CDD:197696" misc_feature order(211..225,229..231,280..282,298..300,337..339, 343..348,355..360,364..372,376..378) /gene="HMRA1" /locus_tag="YCR097W" /gene_synonym="YCR097WB" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(217..219,226..228,346..348,355..360,367..369) /gene="HMRA1" /locus_tag="YCR097W" /gene_synonym="YCR097WB" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" ORIGIN
atggatgatatttgtagtatggcggaaaacataaacagaactctgtttaacattctaggtactgagattgatgaaatcaatctcaatactaataatctttataattttataatggaaagtaatttgactaaagtagagcaacatacattacacaaaaatatttctaacaataggttagaaatataccaccacattaaaaaagagaagagcccaaagggaaaatcatcaatatcaccccaagcacgggcatttttagaacaggtttttagaagaaagcaaagccttaattccaaggaaaaagaagaagttgcaaagaaatgtggcattactccacttcaagtaagagtttggttcataaataaacgtatgagatctaaataa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]