2025-04-20 02:50:25, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001178692 777 bp mRNA linear PLN 17-DEC-2024 DEFINITION Saccharomyces cerevisiae S288C nicotinamide-nucleotide adenylyltransferase (POF1), partial mRNA. ACCESSION NM_001178692 VERSION NM_001178692.1 DBLINK BioProject: PRJNA128 KEYWORDS RefSeq. SOURCE Saccharomyces cerevisiae S288C ORGANISM Saccharomyces cerevisiae S288C Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. REFERENCE 1 (bases 1 to 777) AUTHORS Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M., Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S., Weng,S. and Cherry,J.M. TITLE New data and collaborations at the Saccharomyces Genome Database: updated reference genome, alleles, and the Alliance of Genome Resources JOURNAL Genetics 220 (4) (2022) PUBMED 34897464 REFERENCE 2 (bases 1 to 777) AUTHORS Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B., Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M., Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and Oliver,S.G. TITLE Life with 6000 genes JOURNAL Science 274 (5287), 546 (1996) PUBMED 8849441 REFERENCE 3 (bases 1 to 777) AUTHORS Oliver,S.G., van der Aart,Q.J., Agostoni-Carbone,M.L., Aigle,M., Alberghina,L., Alexandraki,D., Antoine,G., Anwar,R., Ballesta,J.P., Benit,P. et al. TITLE The complete DNA sequence of yeast chromosome III JOURNAL Nature 357 (6373), 38-46 (1992) PUBMED 1574125 REFERENCE 4 (bases 1 to 777) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (17-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 777) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (16-JAN-2015) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Protein update by submitter REFERENCE 6 (bases 1 to 777) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (12-APR-2011) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Sequence update by submitter REFERENCE 7 (bases 1 to 777) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (27-MAY-2010) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Protein update by submitter REFERENCE 8 (bases 1 to 777) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (21-MAY-2010) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Protein update by submitter REFERENCE 9 (bases 1 to 777) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (11-DEC-2009) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA COMMENT REVIEWED REFSEQ: This record has been curated by SGD. This record is derived from an annotated genomic sequence (NC_001135). ##Genome-Annotation-Data-START## Annotation Provider :: SGD Annotation Status :: Full Annotation Annotation Version :: R64-4-1 URL :: http://www.yeastgenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..777 /organism="Saccharomyces cerevisiae S288C" /mol_type="mRNA" /strain="S288C" /db_xref="taxon:559292" /chromosome="III" gene <1..>777 /gene="POF1" /locus_tag="YCL047C" /db_xref="GeneID:850310" CDS 1..777 /gene="POF1" /locus_tag="YCL047C" /EC_number="2.7.7.1" /experiment="EXISTENCE:direct assay:GO:0000309 nicotinamide-nucleotide adenylyltransferase activity [PMID:24759102]" /experiment="EXISTENCE:direct assay:GO:0005634 nucleus [PMID:24759102]" /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm [PMID:24759102]" /experiment="EXISTENCE:direct assay:GO:0016887 ATP hydrolysis activity [PMID:22204397]" /experiment="EXISTENCE:genetic interaction:GO:0000309 nicotinamide-nucleotide adenylyltransferase activity [PMID:24759102]" /experiment="EXISTENCE:genetic interaction:GO:0001403 invasive growth in response to glucose limitation [PMID:21460040]" /experiment="EXISTENCE:genetic interaction:GO:0007124 pseudohyphal growth [PMID:21460040]" /experiment="EXISTENCE:genetic interaction:GO:0034356 NAD biosynthesis via nicotinamide riboside salvage pathway [PMID:24759102]" /experiment="EXISTENCE:mutant phenotype:GO:0036503 ERAD pathway [PMID:22204397]" /experiment="EXISTENCE:physical interaction:GO:0036503 ERAD pathway [PMID:22204397]" /note="Nicotinamide mononucleotide-specific adenylyltransferase (NMNAT); catalyzes the conversion of nicotinamide mononucleotide (NMN) to nicotinamide adenine dinucleotide (NAD+); role in the nicotinamide riboside (NR) salvage pathway of NAD+ biosynthesis; involved in NR and NAD+ homeostasis; ATPase involved in protein quality control and filamentation pathways; interacts physically with Kss1p and suppresses the filamentation defect of a kss1 deletion" /codon_start=1 /product="nicotinamide-nucleotide adenylyltransferase" /protein_id="NP_009883.1" /db_xref="GeneID:850310" /db_xref="SGD:S000000552" /translation="
MKKTFEQFRKSNLLFQVLKGPQHLECQKLFVLDSSFNPPHLAHFQLLSQTIKNFKLKDTRSHVLLLLAVNNADKLPKPASFPTRLEMMCLFADYLQEKLPQSVVSVGLTVFSKFIDKDKILHEQFVKGCSADIGYLVGFDTIARIFDEKYYHPLKISDVMESFMSGSQLYCLARGDCHLSAESQLRYASDILEGKFEPVIPREWGARIHVMQNDYPALRNVSSSEIRNKLKNGQVESLKDELPLCIYDYLINNKTIFD"
misc_feature 91..762 /gene="POF1" /locus_tag="YCL047C" /note="Nicotinamide/nicotinate mononucleotide adenylyltransferase; Region: NMNAT; cd02165" /db_xref="CDD:185680" misc_feature order(94..108,118..120,124..129,136..138,211..213, 334..342,403..405,409..414,418..423,448..453,517..522, 661..663) /gene="POF1" /locus_tag="YCL047C" /note="active site" /db_xref="CDD:185680" misc_feature 118..129 /gene="POF1" /locus_tag="YCL047C" /note="(T/H)XGH motif; other site" /db_xref="CDD:185680" ORIGIN
atgaagaagacgttcgagcagtttcgaaaaagcaatttactatttcaggttctcaaaggaccccagcatctagaatgtcagaagttatttgtccttgattcttcattcaatccaccacatctggcccattttcaactactatcgcagactattaaaaacttcaaattgaaggacacccgttcgcatgttttattactgttagcggtgaataatgcagataagttgcctaagccggcatcttttccaactcgtctggaaatgatgtgcttattcgctgactaccttcaggagaagctcccccaatctgtagtatctgtcgggttgactgttttctcgaaattcatcgacaaggacaaaatattacatgagcaatttgttaaaggatgcagtgcagatataggctacttagttggttttgatacaattgctaggatctttgatgaaaaatattatcatcctttaaaaatcagtgatgtaatggagagcttcatgtcgggatctcaattatattgcttggcgagaggcgattgccatctcagtgctgaatcgcaactaagatacgccagtgacatccttgagggaaaattcgaaccggtaataccaagagaatggggcgctaggattcatgttatgcaaaatgattatccagcattaagaaatgtttcatcatccgagattaggaacaaactgaagaatgggcaagtggagagtttgaaagacgagttgccattgtgcatatacgattatttgatcaataataagacaatatttgattga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]