GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-04-20 02:50:25, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_001178692             777 bp    mRNA    linear   PLN 17-DEC-2024
DEFINITION  Saccharomyces cerevisiae S288C nicotinamide-nucleotide
            adenylyltransferase (POF1), partial mRNA.
ACCESSION   NM_001178692
VERSION     NM_001178692.1
DBLINK      BioProject: PRJNA128
KEYWORDS    RefSeq.
SOURCE      Saccharomyces cerevisiae S288C
  ORGANISM  Saccharomyces cerevisiae S288C
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Saccharomyces.
REFERENCE   1  (bases 1 to 777)
  AUTHORS   Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M.,
            Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S.,
            Weng,S. and Cherry,J.M.
  TITLE     New data and collaborations at the Saccharomyces Genome Database:
            updated reference genome, alleles, and the Alliance of Genome
            Resources
  JOURNAL   Genetics 220 (4) (2022)
   PUBMED   34897464
REFERENCE   2  (bases 1 to 777)
  AUTHORS   Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B.,
            Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M.,
            Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and
            Oliver,S.G.
  TITLE     Life with 6000 genes
  JOURNAL   Science 274 (5287), 546 (1996)
   PUBMED   8849441
REFERENCE   3  (bases 1 to 777)
  AUTHORS   Oliver,S.G., van der Aart,Q.J., Agostoni-Carbone,M.L., Aigle,M.,
            Alberghina,L., Alexandraki,D., Antoine,G., Anwar,R., Ballesta,J.P.,
            Benit,P. et al.
  TITLE     The complete DNA sequence of yeast chromosome III
  JOURNAL   Nature 357 (6373), 38-46 (1992)
   PUBMED   1574125
REFERENCE   4  (bases 1 to 777)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (17-DEC-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 777)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2015) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   6  (bases 1 to 777)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (12-APR-2011) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Sequence update by submitter
REFERENCE   7  (bases 1 to 777)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (27-MAY-2010) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   8  (bases 1 to 777)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAY-2010) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   9  (bases 1 to 777)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (11-DEC-2009) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by SGD. This record
            is derived from an annotated genomic sequence (NC_001135).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: SGD
            Annotation Status   :: Full Annotation
            Annotation Version  :: R64-4-1
            URL                 :: http://www.yeastgenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..777
                     /organism="Saccharomyces cerevisiae S288C"
                     /mol_type="mRNA"
                     /strain="S288C"
                     /db_xref="taxon:559292"
                     /chromosome="III"
     gene            <1..>777
                     /gene="POF1"
                     /locus_tag="YCL047C"
                     /db_xref="GeneID:850310"
     CDS             1..777
                     /gene="POF1"
                     /locus_tag="YCL047C"
                     /EC_number="2.7.7.1"
                     /experiment="EXISTENCE:direct assay:GO:0000309
                     nicotinamide-nucleotide adenylyltransferase activity
                     [PMID:24759102]"
                     /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
                     [PMID:24759102]"
                     /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
                     [PMID:24759102]"
                     /experiment="EXISTENCE:direct assay:GO:0016887 ATP
                     hydrolysis activity [PMID:22204397]"
                     /experiment="EXISTENCE:genetic interaction:GO:0000309
                     nicotinamide-nucleotide adenylyltransferase activity
                     [PMID:24759102]"
                     /experiment="EXISTENCE:genetic interaction:GO:0001403
                     invasive growth in response to glucose limitation
                     [PMID:21460040]"
                     /experiment="EXISTENCE:genetic interaction:GO:0007124
                     pseudohyphal growth [PMID:21460040]"
                     /experiment="EXISTENCE:genetic interaction:GO:0034356 NAD
                     biosynthesis via nicotinamide riboside salvage pathway
                     [PMID:24759102]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0036503 ERAD
                     pathway [PMID:22204397]"
                     /experiment="EXISTENCE:physical interaction:GO:0036503
                     ERAD pathway [PMID:22204397]"
                     /note="Nicotinamide mononucleotide-specific
                     adenylyltransferase (NMNAT); catalyzes the conversion of
                     nicotinamide mononucleotide (NMN) to nicotinamide adenine
                     dinucleotide (NAD+); role in the nicotinamide riboside
                     (NR) salvage pathway of NAD+ biosynthesis; involved in NR
                     and NAD+ homeostasis; ATPase involved in protein quality
                     control and filamentation pathways; interacts physically
                     with Kss1p and suppresses the filamentation defect of a
                     kss1 deletion"
                     /codon_start=1
                     /product="nicotinamide-nucleotide adenylyltransferase"
                     /protein_id="NP_009883.1"
                     /db_xref="GeneID:850310"
                     /db_xref="SGD:S000000552"
                     /translation="
MKKTFEQFRKSNLLFQVLKGPQHLECQKLFVLDSSFNPPHLAHFQLLSQTIKNFKLKDTRSHVLLLLAVNNADKLPKPASFPTRLEMMCLFADYLQEKLPQSVVSVGLTVFSKFIDKDKILHEQFVKGCSADIGYLVGFDTIARIFDEKYYHPLKISDVMESFMSGSQLYCLARGDCHLSAESQLRYASDILEGKFEPVIPREWGARIHVMQNDYPALRNVSSSEIRNKLKNGQVESLKDELPLCIYDYLINNKTIFD"
     misc_feature    91..762
                     /gene="POF1"
                     /locus_tag="YCL047C"
                     /note="Nicotinamide/nicotinate mononucleotide
                     adenylyltransferase; Region: NMNAT; cd02165"
                     /db_xref="CDD:185680"
     misc_feature    order(94..108,118..120,124..129,136..138,211..213,
                     334..342,403..405,409..414,418..423,448..453,517..522,
                     661..663)
                     /gene="POF1"
                     /locus_tag="YCL047C"
                     /note="active site"
                     /db_xref="CDD:185680"
     misc_feature    118..129
                     /gene="POF1"
                     /locus_tag="YCL047C"
                     /note="(T/H)XGH motif; other site"
                     /db_xref="CDD:185680"
ORIGIN      
atgaagaagacgttcgagcagtttcgaaaaagcaatttactatttcaggttctcaaaggaccccagcatctagaatgtcagaagttatttgtccttgattcttcattcaatccaccacatctggcccattttcaactactatcgcagactattaaaaacttcaaattgaaggacacccgttcgcatgttttattactgttagcggtgaataatgcagataagttgcctaagccggcatcttttccaactcgtctggaaatgatgtgcttattcgctgactaccttcaggagaagctcccccaatctgtagtatctgtcgggttgactgttttctcgaaattcatcgacaaggacaaaatattacatgagcaatttgttaaaggatgcagtgcagatataggctacttagttggttttgatacaattgctaggatctttgatgaaaaatattatcatcctttaaaaatcagtgatgtaatggagagcttcatgtcgggatctcaattatattgcttggcgagaggcgattgccatctcagtgctgaatcgcaactaagatacgccagtgacatccttgagggaaaattcgaaccggtaataccaagagaatggggcgctaggattcatgttatgcaaaatgattatccagcattaagaaatgtttcatcatccgagattaggaacaaactgaagaatgggcaagtggagagtttgaaagacgagttgccattgtgcatatacgattatttgatcaataataagacaatatttgattga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]