GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-23 11:03:58, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       XM_063287443            1535 bp    mRNA    linear   ROD 22-FEB-2024
DEFINITION  PREDICTED: Rattus norvegicus argonaute RISC component 4 (Ago4),
            transcript variant X4, mRNA.
ACCESSION   XM_063287443
VERSION     XM_063287443.1
DBLINK      BioProject: PRJNA1074393
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_086023) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_036323735.1-RS_2024_02
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 02/09/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1535
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN/NHsdMcwi"
                     /bio_material="RGD 61498"
                     /db_xref="taxon:10116"
                     /chromosome="5"
                     /sex="male"
                     /tissue_type="kidney, spleen, liver"
                     /geo_loc_name="USA: Wisconsin, Milwaukee"
                     /lat_lon="43.05 N 88.04 W"
                     /collected_by="Rebecca Schilling, Melinda Dwinell"
     gene            1..1535
                     /gene="Ago4"
                     /gene_synonym="Eif2c4"
                     /note="argonaute RISC component 4; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 8 long
                     SRA reads, 1 Protein"
                     /db_xref="GeneID:298533"
                     /db_xref="RGD:1304583"
     CDS             137..1393
                     /gene="Ago4"
                     /gene_synonym="Eif2c4"
                     /codon_start=1
                     /product="protein argonaute-4 isoform X4"
                     /protein_id="XP_063143513.1"
                     /db_xref="GeneID:298533"
                     /db_xref="RGD:1304583"
                     /translation="
MEALGPGPPASLFQPPRRPGLGTVGKPIRLLANHFQVQIPKIDVYHYDVDIKPEKRPRRVNREVVDTMVRHFKMQIFGDRQPGYDGKRNMYTAHPLPIGRDRVDMEVTLPGEGKDQTFKVSVQWVSVVSLQLLLEALAGHLSEVPDDSVQALDVITRHLPSMRYTPVGRSFFSPPEGYYHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYRAQPIIEFMCEVLDIQNINEQTKPLTDSQRVKFTKEIRGLKVEVTHCGQMKRKYRVCNVTRRPASHQTFPLQLENGQAMECTVAQYFKQKYNLQLKYSHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATARSAPDRQEEISRLVKSNSVLGGPDPYLKEFGIVVHNEMTELMGRVLPAPMLQYGGRELH"
ORIGIN      
cgccccttgcccagcgctcgcgtcttcgcggcgccgcttcagcgccaatattccggagagcaagcgttacgcggcggcggcggggcccggagcgggaggcgccggggaccggggcgaggcggcccccgccgccgccatggaggcgctgggacccggacctccagccagcctcttccagccaccccggcgtcctggccttggcactgttgggaaaccaatccgactgttagccaatcattttcaggttcagattcctaaaatagatgtgtatcactatgatgtggatattaaaccggaaaaacggcctcgtagagtcaacagggaggtagtagacactatggtgcgacacttcaagatgcagatatttggagatcggcagcctggctatgatggcaaaagaaacatgtacacagcacatccactgccaatcggacgggatagggttgatatggaggtgaccctcccaggtgagggcaaggaccaaacgttcaaagtgtcagtgcaatgggtgtcagttgtgagccttcagctgcttttagaagctttagctggacacctgagtgaagtcccagatgactcagtacaagcccttgacgtgattacaaggcatctcccctctatgaggtacactccagtaggccggtcttttttctcacctcctgaaggttactaccaccctctgggagggggcagagaggtctggttcggctttcaccagtctgtgcgccctgccatgtggaagatgatgctcaacattgatgtatctgcaactgctttctaccgggctcagcccatcattgagttcatgtgtgaggttttagacatccagaacatcaacgagcagacgaaacctctaacagactcccagcgtgtcaagtttaccaaagaaatcaggggtcttaaagttgaggtgactcactgtggacagatgaaacgaaaatatcgagtttgtaatgtgacaagacgaccagccagtcatcaaaccttccctttgcagctagaaaatggtcaagctatggaatgtacagtagctcagtattttaagcaaaaatataatctgcagctgaaatactcccatcttccctgccttcaagtgggacaagagcaaaagcatacatacctgccacttgaggtctgtaatatagtagcagggcagagatgtataaagaagctcacagacaaccagacatccaccatgatcaaagccacagcgagatctgctcctgacagacaggaggaaatcagtagactggtgaagagcaacagcgtgctgggtggacctgacccatacctgaaggaatttgggatcgttgtgcacaatgagatgacggaactcatgggcagggtgcttccggcgccaatgctgcagtatggaggccgggagcttcactgaccaacttcgtaaaatctccaaggatgcagggatgcccatccagggtcaaccatgtttctgcaaatatgctcaaggtgcagacagtgtggagcccatgtttaaacatctgaaaatgacatatgtgggcctgcagctaatagtg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]