GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-07-04 19:52:54, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_063261678            2012 bp    mRNA    linear   ROD 22-FEB-2024
DEFINITION  PREDICTED: Rattus norvegicus trafficking protein particle complex
            subunit 6B (Trappc6b), transcript variant X1, mRNA.
ACCESSION   XM_063261678
VERSION     XM_063261678.1
DBLINK      BioProject: PRJNA1074393
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_086024) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_036323735.1-RS_2024_02
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 02/09/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2012
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN/NHsdMcwi"
                     /bio_material="RGD 61498"
                     /db_xref="taxon:10116"
                     /chromosome="6"
                     /sex="male"
                     /tissue_type="kidney, spleen, liver"
                     /geo_loc_name="USA: Wisconsin, Milwaukee"
                     /lat_lon="43.05 N 88.04 W"
                     /collected_by="Rebecca Schilling, Melinda Dwinell"
     gene            1..2012
                     /gene="Trappc6b"
                     /gene_synonym="RGD1309325"
                     /note="trafficking protein particle complex subunit 6B;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 1 EST, 80 long SRA reads, 3 Proteins"
                     /db_xref="GeneID:299075"
                     /db_xref="RGD:1309325"
     CDS             223..738
                     /gene="Trappc6b"
                     /gene_synonym="RGD1309325"
                     /codon_start=1
                     /product="trafficking protein particle complex subunit 6B
                     isoform X1"
                     /protein_id="XP_063117748.1"
                     /db_xref="GeneID:299075"
                     /db_xref="RGD:1309325"
                     /translation="
MADEALFLLLHNEMVSGVYKSAEQGEVENGRCITKLENMGFRVGQGLIERFTKDTARFKDELDIMKFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLIQLSAGKQYLEHASKYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKFNVFVLYIHIYFTFSFKPRGN"
     misc_feature    229..681
                     /gene="Trappc6b"
                     /gene_synonym="RGD1309325"
                     /note="Trs33 subunit of the TRAPP complex; Region:
                     TRAPPC6A_Trs33; cd14944"
                     /db_xref="CDD:271347"
     misc_feature    order(235..237,244..246,256..258,529..534,562..564,
                     574..576)
                     /gene="Trappc6b"
                     /gene_synonym="RGD1309325"
                     /note="synbindin interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:271347"
     misc_feature    order(238..243,247..255,259..264,271..273,325..327,
                     337..339,346..351,358..363,370..372,445..447,454..456,
                     514..516,583..585)
                     /gene="Trappc6b"
                     /gene_synonym="RGD1309325"
                     /note="BET3 interface [polypeptide binding]; other site"
                     /db_xref="CDD:271347"
     polyA_site      2012
                     /gene="Trappc6b"
                     /gene_synonym="RGD1309325"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
cagcccggaagttgctcacgccccacaccctgccggaacgccgggtgtggggttgtcatagggtctcaaaggcccagtggcggccgccctggggaggggcgcggtccacagcggccttaggaccggggtaggccgcggcgcacagcgtgcgacgcggggtaacgggaacctcgagtcccgcactaattggagccgactcggcgctggagggatcggcgggaaatggcggacgaggcgttgtttttgcttctccataacgagatggtgtccggagtatataagtccgccgagcagggggaagtggaaaatggacggtgtattactaagctggaaaacatggggtttcgagtgggacaaggattgatagaaaggtttacaaaagatactgcaaggttcaaggatgaattagacatcatgaagttcatatgtaaagatttttggactacggtattcaagaaacaaattgacaatctaaggacaaatcatcagggcatatatgtgcttcaggacaacaaatttcgactactcattcagctgtctgcaggaaaacagtatttagaacatgcatccaagtatctagcgtttacatgtggcttaatcagaggtggcttgtcaaacttgggaataaaaagtattgtgacagctgaagtatcttcaatgcctgcctgtaagtttaatgtatttgtcttatatatacatatatatttcactttctcttttaaacctagaggaaactaaaaatgttgacaccttcacttcagtgtcctgtatctcacatttatgtattatcttctccctgaagctgctaatgaagaataagattgagttgaattttactgtattacttttctgcccattgacaaagtagtaatgaaatactcagactcaccaagcatggtgactcacaccttcaatcccagcattcaggaaacagaggcaggtcaatcttggtaagtttgaagcttgcctgatctggtcaacatgctgagccccaagccagggctacataaagaaagggagggagaggggagagagagagaaaggaaacagagatatagagacagacctaggatgtaggaaagacacctcctcataaaacagataattatgcggtgggctagactttattgaataccttaaggactgtgaaaagacctctgacatagcaagttcttttttttttttttaagatatatttattttatttataagtacactgtggttgtctacagacacaccagaagagggcatcagatcccattacagatggtcatgagccaccatgtggttgctgggaattgaactcaggaactctggaagagcagccagtgctcttaaccattgagccatgtctccagccccatagcaagttctttgagtgaaacgacttcctgaatagacatgagtatgtgtgcttgatttccttaggcctgaagtcaaagaataatggttggttctgcttccctttcaggcaaattccaggtgatgatacagaagctgtagagtgaggtgatggctcctgggcagagcattgcgcgtcctgatttcaccttctcgttggatatctgcgttggagcaaatcgttagctctccagagtcactagagcaaatcaaagtagatacaggtcctttgacataaactaactgaactgttcaaagcaatttcagtgaactaaacgccaagatgccaggctcttcattttaaacatctttatttccgtagtatgataagcatttaaccatcaattgggaagtgaaactcagggtgtgttgaattgctgtataaaaaagtacgtgtcaatcagaatagtttgtgttcaaatgaccaaaatttgttgaagtataaatctgttttagttatttaaaacaaaccactatgttaaattaagcttcatttttattgtattgcttataatttatttctgtcaagagaactcctatgcttatataaggatttcatttatacattgtgtatatatgtgtatatataaatacatgcattactgtctaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]