GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-01-19 02:31:01, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       NM_019255                822 bp    mRNA    linear   ROD 20-JUN-2025
DEFINITION  Rattus norvegicus calcium voltage-gated channel auxiliary subunit
            gamma 1 (Cacng1), mRNA.
ACCESSION   NM_019255
VERSION     NM_019255.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 822)
  AUTHORS   Ursu,D., Schuhmeier,R.P., Freichel,M., Flockerzi,V. and Melzer,W.
  TITLE     Altered inactivation of Ca2+ current and Ca2+ release in mouse
            muscle fibers deficient in the DHP receptor gamma1 subunit
  JOURNAL   J Gen Physiol 124 (5), 605-618 (2004)
   PUBMED   15504904
REFERENCE   2  (bases 1 to 822)
  AUTHORS   Chu,P.J., Robertson,H.M. and Best,P.M.
  TITLE     Calcium channel gamma subunits provide insights into the evolution
            of this gene family
  JOURNAL   Gene 280 (1-2), 37-48 (2001)
   PUBMED   11738816
REFERENCE   3  (bases 1 to 822)
  AUTHORS   Freise,D., Held,B., Wissenbach,U., Pfeifer,A., Trost,C.,
            Himmerkus,N., Schweig,U., Freichel,M., Biel,M., Hofmann,F., Hoth,M.
            and Flockerzi,V.
  TITLE     Absence of the gamma subunit of the skeletal muscle dihydropyridine
            receptor increases L-type Ca2+ currents and alters channel
            inactivation properties
  JOURNAL   J Biol Chem 275 (19), 14476-14481 (2000)
   PUBMED   10799530
REFERENCE   4  (bases 1 to 822)
  AUTHORS   Eberst,R., Dai,S., Klugbauer,N. and Hofmann,F.
  TITLE     Identification and functional characterization of a calcium channel
            gamma subunit
  JOURNAL   Pflugers Arch 433 (5), 633-637 (1997)
   PUBMED   9049149
REFERENCE   5  (bases 1 to 822)
  AUTHORS   Iles,D.E., Segers,B., Sengers,R.C., Monsieurs,K., Heytens,L.,
            Halsall,P.J., Hopkins,P.M., Ellis,F.R., Hall-Curran,J.L.,
            Stewart,A.D. et al.
  TITLE     Genetic mapping of the beta 1- and gamma-subunits of the human
            skeletal muscle L-type voltage-dependent calcium channel on
            chromosome 17q and exclusion as candidate genes for malignant
            hyperthermia susceptibility
  JOURNAL   Hum Mol Genet 2 (7), 863-868 (1993)
   PUBMED   8395940
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from Y09453.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: Y09453.1, FQ215004.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN06621351 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..822
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="10"
                     /map="10q32.1"
     gene            1..822
                     /gene="Cacng1"
                     /gene_synonym="Cacng"
                     /note="calcium voltage-gated channel auxiliary subunit
                     gamma 1"
                     /db_xref="GeneID:29658"
                     /db_xref="RGD:2249"
     exon            1..242
                     /gene="Cacng1"
                     /gene_synonym="Cacng"
                     /inference="alignment:Splign:2.1.0"
     CDS             11..682
                     /gene="Cacng1"
                     /gene_synonym="Cacng"
                     /note="calcium channel, voltage-dependent, gamma subunit
                     1; dihydropyridine-sensitive L-type, skeletal muscle
                     calcium channel subunit gamma"
                     /codon_start=1
                     /product="voltage-dependent calcium channel gamma-1
                     subunit"
                     /protein_id="NP_062128.1"
                     /db_xref="GeneID:29658"
                     /db_xref="RGD:2249"
                     /translation="
MSQTKTAKVRVTLFFILAGGVLAMVAVVTDHWAVLSPHLEHHNETCVAAHFGLWRICTTWVAMHNQDKNCDGTIPAGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSLGFIIIGSICAFLSFGNKRDYLLRPASMFYAFAGLCLIVSVEVMRQSVKRMIDSEDTVWIEYYYSWSFACACAGFTLLFLGGLFLLLFSLPRMPQNPWESCMDTESEH"
     misc_feature    41..97
                     /gene="Cacng1"
                     /gene_synonym="Cacng"
                     /note="propagated from UniProtKB/Swiss-Prot (P97707.1);
                     transmembrane region"
     misc_feature    71..574
                     /gene="Cacng1"
                     /gene_synonym="Cacng"
                     /note="PMP-22/EMP/MP20/Claudin tight junction; Region:
                     Claudin_2; pfam13903"
                     /db_xref="CDD:372799"
     misc_feature    137..139
                     /gene="Cacng1"
                     /gene_synonym="Cacng"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (P97707.1); glycosylation site"
     misc_feature    248..250
                     /gene="Cacng1"
                     /gene_synonym="Cacng"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (P97707.1); glycosylation site"
     misc_feature    338..400
                     /gene="Cacng1"
                     /gene_synonym="Cacng"
                     /note="propagated from UniProtKB/Swiss-Prot (P97707.1);
                     transmembrane region"
     misc_feature    416..478
                     /gene="Cacng1"
                     /gene_synonym="Cacng"
                     /note="propagated from UniProtKB/Swiss-Prot (P97707.1);
                     transmembrane region"
     misc_feature    551..625
                     /gene="Cacng1"
                     /gene_synonym="Cacng"
                     /note="propagated from UniProtKB/Swiss-Prot (P97707.1);
                     transmembrane region"
     exon            243..317
                     /gene="Cacng1"
                     /gene_synonym="Cacng"
                     /inference="alignment:Splign:2.1.0"
     exon            318..455
                     /gene="Cacng1"
                     /gene_synonym="Cacng"
                     /inference="alignment:Splign:2.1.0"
     exon            456..822
                     /gene="Cacng1"
                     /gene_synonym="Cacng"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
aacaaacgccatgtcacagaccaaaacagcgaaggttcgcgtgaccctcttcttcatcctggcgggtggagtgctcgccatggtggccgtggtgaccgaccactgggccgtgctgagtccacacctggagcaccacaatgagacgtgcgtggcagcccacttcggcctttggaggatctgcaccacttgggttgccatgcacaaccaagacaagaactgtgacggcaccataccagcgggggaaaagaattgctcctacttcaggcacttcaacccaggagagagctcggaaatctttgaattcaccactcagaaggagtacagcatctcggcagcggccatcgctatcttcagccttggcttcatcatcataggctccatctgtgcctttctgtccttcgggaataagcgtgattacctgctaaggccggcatccatgttttatgcctttgcagggctctgcctcatcgtgtcggtggaggtcatgaggcagtcggtgaagcgtatgattgacagcgaggacacggtctggattgagtactattattcgtggtctttcgcctgcgcgtgtgccggcttcactttgctcttcctcggtgggctgtttctcctgctgttctccctgcctcggatgccccagaacccctgggaatcctgcatggacactgagtcagagcactagatcaaagcagagtctttcggaggtgaggagggagtctcacatctgccctgacttcttgtctatcgtgtgtctctccctctgagctcctctacaaacagtgcacatggacacaacccagacctgcccaggtcagaggaagc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]