GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-06-21 11:12:47, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_001329893            1720 bp    mRNA    linear   ROD 23-JUN-2025
DEFINITION  Rattus norvegicus selenium binding protein 1 (Selenbp1), mRNA.
ACCESSION   NM_001329893 NM_080892 XM_008761279 XM_008775217
VERSION     NM_001329893.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1720)
  AUTHORS   Wang,J., Qu,D., An,J., Yuan,G. and Liu,Y.
  TITLE     Integrated microarray analysis provided novel insights to the
            pathogenesis of glaucoma
  JOURNAL   Mol Med Rep 16 (6), 8735-8746 (2017)
   PUBMED   28990066
REFERENCE   2  (bases 1 to 1720)
  AUTHORS   Lee,E.K., Shin,Y.J., Park,E.Y., Kim,N.D., Moon,A., Kwack,S.J.,
            Son,J.Y., Kacew,S., Lee,B.M., Bae,O.N. and Kim,H.S.
  TITLE     Selenium-binding protein 1: a sensitive urinary biomarker to detect
            heavy metal-induced nephrotoxicity
  JOURNAL   Arch Toxicol 91 (4), 1635-1648 (2017)
   PUBMED   27578022
  REMARK    GeneRIF: SBP1 may play a critical role in the pathological
            processes underlying chemical-induced nephrotoxicity; urinary
            excretion of SBP1 might be a sensitive and specific biomarker to
            detect early stages of kidney injury.
REFERENCE   3  (bases 1 to 1720)
  AUTHORS   Gonzales,P.A., Pisitkun,T., Hoffert,J.D., Tchapyjnikov,D.,
            Star,R.A., Kleta,R., Wang,N.S. and Knepper,M.A.
  TITLE     Large-scale proteomics and phosphoproteomics of urinary exosomes
  JOURNAL   J Am Soc Nephrol 20 (2), 363-379 (2009)
   PUBMED   19056867
REFERENCE   4  (bases 1 to 1720)
  AUTHORS   Wu,Y. and Smas,C.M.
  TITLE     Wdnm1-like, a new adipokine with a role in MMP-2 activation
  JOURNAL   Am J Physiol Endocrinol Metab 295 (1), E205-E215 (2008)
   PUBMED   18492766
REFERENCE   5  (bases 1 to 1720)
  AUTHORS   Palmer,D.J., Kelly,V.C., Smit,A.M., Kuy,S., Knight,C.G. and
            Cooper,G.J.
  TITLE     Human colostrum: identification of minor proteins in the aqueous
            phase by proteomics
  JOURNAL   Proteomics 6 (7), 2208-2216 (2006)
   PUBMED   16502470
REFERENCE   6  (bases 1 to 1720)
  AUTHORS   Florea,L., Di Francesco,V., Miller,J., Turner,R., Yao,A.,
            Harris,M., Walenz,B., Mobarry,C., Merkulov,G.V., Charlab,R.,
            Dew,I., Deng,Z., Istrail,S., Li,P. and Sutton,G.
  TITLE     Gene and alternative splicing annotation with AIR
  JOURNAL   Genome Res 15 (1), 54-66 (2005)
   PUBMED   15632090
REFERENCE   7  (bases 1 to 1720)
  AUTHORS   Lanfear,J., Fleming,J., Walker,M. and Harrison,P.
  TITLE     Different patterns of regulation of the genes encoding the closely
            related 56 kDa selenium- and acetaminophen-binding proteins in
            normal tissues and during carcinogenesis
  JOURNAL   Carcinogenesis 14 (3), 335-340 (1993)
   PUBMED   8453708
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC074008.1.
            
            On or before Feb 28, 2022 this sequence version replaced
            NM_080892.1, XM_008761279.1, XM_008775217.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC074008.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5756307, SAMEA5760383
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1720
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="2"
                     /map="2q34"
     gene            1..1720
                     /gene="Selenbp1"
                     /gene_synonym="MTO; rSBP; Selenbp2"
                     /note="selenium binding protein 1"
                     /db_xref="GeneID:103689947"
                     /db_xref="RGD:620571"
     exon            1..76
                     /gene="Selenbp1"
                     /gene_synonym="MTO; rSBP; Selenbp2"
                     /inference="alignment:Splign:2.1.0"
     CDS             73..1491
                     /gene="Selenbp1"
                     /gene_synonym="MTO; rSBP; Selenbp2"
                     /EC_number="1.8.3.4"
                     /note="SP56; SBP56; selenium-binding protein 2; 56 kDa
                     selenium-binding protein"
                     /codon_start=1
                     /product="methanethiol oxidase"
                     /protein_id="NP_001316822.1"
                     /db_xref="GeneID:103689947"
                     /db_xref="RGD:620571"
                     /translation="
MATKCTKCGPGYATPLEAMKGPREEIVYLPCIYRNTGIEAPDYLATVDVDPKSPHYSQVIHRLPMPHLKDELHHSGWNTCSSCFGDSTKSRDKLILPSIISSRIYVVDVGSEPRAPKLHKVIEPNEIHAKCNLGNLHTSHCLASGEVMISSLGDPQGNGKGGFVLLDGETFEVKGTWEKPGGEAPMGYDFWYQPRHNIMVSTEWAAPNVFKDGFNPAHVEAGLYGSHIHVWDWQRHEIIQTLQMKDGLIPLEIRFLHDPDATQGFVGCALSSNIQRFYKNEGGTWSVEKVIQVPSKKVKGWMLPEMPGLITDILLSLDDRFLYFSNWLHGDIRQYDISNPKKPRLTGQIFLGGSIVKGGSVQVLEDQELTCQPEPLVVKGKRVPGGPQMIQLSLDGKRLYVTTSLYSAWDKQFYPNLIREGSVMLQIDVDTANGGLKLNPNFLVDFGKEPLGPALAHELRYPGGDCSSDIWI"
     misc_feature    76..78
                     /gene="Selenbp1"
                     /gene_synonym="MTO; rSBP; Selenbp2"
                     /note="N-acetylalanine.
                     /evidence=ECO:0000250|UniProtKB:Q13228; propagated from
                     UniProtKB/Swiss-Prot (Q8VIF7.1); acetylation site"
     misc_feature    91..1488
                     /gene="Selenbp1"
                     /gene_synonym="MTO; rSBP; Selenbp2"
                     /note="56kDa selenium binding protein (SBP56); Region:
                     SBP56; pfam05694"
                     /db_xref="CDD:461716"
     misc_feature    403..405
                     /gene="Selenbp1"
                     /gene_synonym="MTO; rSBP; Selenbp2"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:Q13228; propagated from
                     UniProtKB/Swiss-Prot (Q8VIF7.1); phosphorylation site"
     misc_feature    1471..1473
                     /gene="Selenbp1"
                     /gene_synonym="MTO; rSBP; Selenbp2"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P17563; propagated from
                     UniProtKB/Swiss-Prot (Q8VIF7.1); phosphorylation site"
     exon            77..133
                     /gene="Selenbp1"
                     /gene_synonym="MTO; rSBP; Selenbp2"
                     /inference="alignment:Splign:2.1.0"
     exon            134..246
                     /gene="Selenbp1"
                     /gene_synonym="MTO; rSBP; Selenbp2"
                     /inference="alignment:Splign:2.1.0"
     exon            247..432
                     /gene="Selenbp1"
                     /gene_synonym="MTO; rSBP; Selenbp2"
                     /inference="alignment:Splign:2.1.0"
     exon            433..553
                     /gene="Selenbp1"
                     /gene_synonym="MTO; rSBP; Selenbp2"
                     /inference="alignment:Splign:2.1.0"
     exon            554..736
                     /gene="Selenbp1"
                     /gene_synonym="MTO; rSBP; Selenbp2"
                     /inference="alignment:Splign:2.1.0"
     exon            737..915
                     /gene="Selenbp1"
                     /gene_synonym="MTO; rSBP; Selenbp2"
                     /inference="alignment:Splign:2.1.0"
     exon            916..994
                     /gene="Selenbp1"
                     /gene_synonym="MTO; rSBP; Selenbp2"
                     /inference="alignment:Splign:2.1.0"
     exon            995..1116
                     /gene="Selenbp1"
                     /gene_synonym="MTO; rSBP; Selenbp2"
                     /inference="alignment:Splign:2.1.0"
     exon            1117..1209
                     /gene="Selenbp1"
                     /gene_synonym="MTO; rSBP; Selenbp2"
                     /inference="alignment:Splign:2.1.0"
     exon            1210..1328
                     /gene="Selenbp1"
                     /gene_synonym="MTO; rSBP; Selenbp2"
                     /inference="alignment:Splign:2.1.0"
     exon            1329..1695
                     /gene="Selenbp1"
                     /gene_synonym="MTO; rSBP; Selenbp2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ccagcactggtctctgctgaacctttgtccattcctagcaaatcctgcaggaccagagtgtcagccagcagcatggctacaaaatgcacaaagtgtggtccaggttatgcgacccctctggaggccatgaaaggaccccgagaggagattgtctacttgccctgcatttaccgaaacacaggcattgaagccccggattatttggccacagtggatgttgaccccaagtctccccattatagccaggtcatccataggctgcccatgccccacctgaaggacgagctgcaccactcagggtggaacacctgcagtagctgctttggggacagcaccaagtcacgcgacaagctgatactgcccagcatcatctcctcccgcatctatgtggtggatgtgggctctgagcctcgtgccccgaagttgcacaaggtcattgagcccaatgaaatccatgccaagtgcaacctgggcaatctgcacaccagccactgcctggccagcggagaggtgatgatcagctccttgggggatccccaggggaatggcaaagggggttttgtgctgctggatggggagaccttcgaggtgaaagggacgtgggagaagcctgggggtgaagctccaatgggctatgacttctggtaccagcctcgacacaacatcatggtcagcactgaatgggcagctcccaatgtcttcaaagatggcttcaaccctgctcatgtggaggctgggctgtatgggagccacatacatgtgtgggactggcagcgacatgagattatccagaccctgcaaatgaaagatgggctgatccccctggagatccgcttcctgcacgacccagatgccacccagggctttgtaggctgcgccctcagctccaacatccagcgcttctacaagaatgagggaggcacctggtcagtggagaaggtgatccaggtgccctccaagaaagtgaagggctggatgttgccagaaatgcctggtttgatcaccgacatcttgctgtccctggatgaccgcttcctctacttcagcaactggctgcacggggacattcggcagtatgacatctctaacccgaagaagcctcgcctcactgggcagatcttccttgggggcagcattgttaaaggaggctctgtacaagtgctggaggaccaagagctaacgtgtcagccggagcccctagtggtcaagggaaaacgagttcctggaggtcctcagatgatccagctcagcttagatgggaagcgtctttacgtcactacatcactgtacagcgcctgggacaagcagttttaccctaatctcattagggaaggctctgtgatgctgcaaattgatgtagatacagcaaatggagggctgaagttgaaccccaactttctggtggactttgggaaagagcctcttgggccagcactggctcatgagcttcgttacccagggggtgattgcagttctgacatctggatctgaaggctagccctaaaggccttcctccacagtcggggtcctccttctgaggagcctagcttcgctctgctctgggtcccaactctccaaggccatgatgagaccatcgagaactgcagagcagtatctcactactaccttgcttgttgtttgtgccattcttaagtgagctcctggaagcaccaagaaataaaatgctgaacctttaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]