LOCUS       NM_001134702            2506 bp    mRNA    linear   ROD 24-JUN-2024
DEFINITION  Rattus norvegicus Meis homeobox 1 (Meis1), mRNA.
ACCESSION   NM_001134702 XM_001054791 XM_001054850 XM_001054906 XM_001054960
            XM_001055028 XM_001070142 XM_001070196 XM_001070244 XM_001070286
            XM_001070326
VERSION     NM_001134702.1
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 2506)
  AUTHORS   Yao,M.Z., Ge,X.Y., Liu,T., Huang,N., Liu,H., Chen,Y., Zhang,Z. and
            Hu,C.P.
  TITLE     MEIS1 regulated proliferation and migration of pulmonary artery
            smooth muscle cells in hypoxia-induced pulmonary hypertension
  JOURNAL   Life Sci 255, 117822 (2020)
   PUBMED   32450174
  REMARK    GeneRIF: MEIS1 regulated the proliferation and migration of
            pulmonary artery smooth muscle cells during hypoxia-induced
            pulmonary hypertension
REFERENCE   2  (bases 1 to 2506)
  AUTHORS   Zhang,Y., Si,Y. and Ma,N.
  TITLE     Meis1 promotes poly (rC)-binding protein 2 expression and inhibits
            angiotensin II-induced cardiomyocyte hypertrophy
  JOURNAL   IUBMB Life 68 (1), 13-22 (2016)
   PUBMED   26597775
REFERENCE   3  (bases 1 to 2506)
  AUTHORS   Pandey,R., Yang,Y., Jackson,L. and Ahmed,R.P.
  TITLE     MicroRNAs regulating meis1 expression and inducing cardiomyocyte
            proliferation
  JOURNAL   Cardiovasc Regen Med 3 (2016)
   PUBMED   28111633
REFERENCE   4  (bases 1 to 2506)
  AUTHORS   Jolma,A., Yin,Y., Nitta,K.R., Dave,K., Popov,A., Taipale,M.,
            Enge,M., Kivioja,T., Morgunova,E. and Taipale,J.
  TITLE     DNA-dependent formation of transcription factor pairs alters their
            binding specificity
  JOURNAL   Nature 527 (7578), 384-388 (2015)
   PUBMED   26550823
REFERENCE   5  (bases 1 to 2506)
  AUTHORS   Spieler,D., Kaffe,M., Knauf,F., Bessa,J., Tena,J.J., Giesert,F.,
            Schormair,B., Tilch,E., Lee,H., Horsch,M., Czamara,D., Karbalai,N.,
            von Toerne,C., Waldenberger,M., Gieger,C., Lichtner,P.,
            Claussnitzer,M., Naumann,R., Muller-Myhsok,B., Torres,M.,
            Garrett,L., Rozman,J., Klingenspor,M., Gailus-Durner,V., Fuchs,H.,
            Hrabe de Angelis,M., Beckers,J., Holter,S.M., Meitinger,T.,
            Hauck,S.M., Laumen,H., Wurst,W., Casares,F., Gomez-Skarmeta,J.L.
            and Winkelmann,J.
  TITLE     Restless legs syndrome-associated intronic common variant in Meis1
            alters enhancer function in the developing telencephalon
  JOURNAL   Genome Res 24 (4), 592-603 (2014)
   PUBMED   24642863
REFERENCE   6  (bases 1 to 2506)
  AUTHORS   Toresson,H., Parmar,M. and Campbell,K.
  TITLE     Expression of Meis and Pbx genes and their protein products in the
            developing telencephalon: implications for regional differentiation
  JOURNAL   Mech Dev 94 (1-2), 183-187 (2000)
   PUBMED   10842069
REFERENCE   7  (bases 1 to 2506)
  AUTHORS   Jacobs,Y., Schnabel,C.A. and Cleary,M.L.
  TITLE     Trimeric association of Hox and TALE homeodomain proteins mediates
            Hoxb2 hindbrain enhancer activity
  JOURNAL   Mol Cell Biol 19 (7), 5134-5142 (1999)
   PUBMED   10373562
REFERENCE   8  (bases 1 to 2506)
  AUTHORS   Knoepfler,P.S., Calvo,K.R., Chen,H., Antonarakis,S.E. and
            Kamps,M.P.
  TITLE     Meis1 and pKnox1 bind DNA cooperatively with Pbx1 utilizing an
            interaction surface disrupted in oncoprotein E2a-Pbx1
  JOURNAL   Proc Natl Acad Sci U S A 94 (26), 14553-14558 (1997)
   PUBMED   9405651
REFERENCE   9  (bases 1 to 2506)
  AUTHORS   Shen,W.F., Montgomery,J.C., Rozenfeld,S., Moskow,J.J.,
            Lawrence,H.J., Buchberg,A.M. and Largman,C.
  TITLE     AbdB-like Hox proteins stabilize DNA binding by the Meis1
            homeodomain proteins
  JOURNAL   Mol Cell Biol 17 (11), 6448-6458 (1997)
   PUBMED   9343407
REFERENCE   10 (bases 1 to 2506)
  AUTHORS   Chang,C.P., Jacobs,Y., Nakamura,T., Jenkins,N.A., Copeland,N.G. and
            Cleary,M.L.
  TITLE     Meis proteins are major in vivo DNA binding partners for wild-type
            but not chimeric Pbx proteins
  JOURNAL   Mol Cell Biol 17 (10), 5679-5687 (1997)
   PUBMED   9315626
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC161984.1.
            
            On or before Sep 5, 2008 this sequence version replaced
            XM_001054960.1, XM_001055028.1, XM_001054850.1, XM_001054791.1,
            XM_001054906.1, XM_001070286.1, XM_001070326.1, XM_001070196.1,
            XM_001070244.1, XM_001070142.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC161984.1, SRR8487227.99997.1
                                           [ECO:0000332]
            RNAseq introns              :: mixed sample support SAMD00132261,
                                           SAMD00132262 [ECO:0006172]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..2506
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="14"
                     /map="14q22"
     gene            1..2506
                     /gene="Meis1"
                     /note="Meis homeobox 1"
                     /db_xref="GeneID:686117"
                     /db_xref="RGD:1585482"
     exon            1..68
                     /gene="Meis1"
                     /inference="alignment:Splign:2.1.0"
     CDS             57..1229
                     /gene="Meis1"
                     /note="Meis1, myeloid ecotropic viral integration site 1
                     homolog"
                     /codon_start=1
                     /product="homeobox protein Meis1"
                     /protein_id="NP_001128174.1"
                     /db_xref="GeneID:686117"
                     /db_xref="RGD:1585482"
                     /translation="

MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDVTRAANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM"

     misc_feature    378..632
                     /gene="Meis1"
                     /note="N-terminal of Homeobox Meis and PKNOX1; Region:
                     Meis_PKNOX_N; pfam16493"
                     /db_xref="CDD:465140"
     misc_feature    order(888..890,1017..1019,1026..1031,1038..1040)
                     /gene="Meis1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    927..1043
                     /gene="Meis1"
                     /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920"
                     /db_xref="CDD:428673"
     exon            69..295
                     /gene="Meis1"
                     /inference="alignment:Splign:2.1.0"
     exon            296..437
                     /gene="Meis1"
                     /inference="alignment:Splign:2.1.0"
     exon            438..488
                     /gene="Meis1"
                     /inference="alignment:Splign:2.1.0"
     exon            489..539
                     /gene="Meis1"
                     /inference="alignment:Splign:2.1.0"
     exon            540..686
                     /gene="Meis1"
                     /inference="alignment:Splign:2.1.0"
     exon            687..798
                     /gene="Meis1"
                     /inference="alignment:Splign:2.1.0"
     exon            799..944
                     /gene="Meis1"
                     /inference="alignment:Splign:2.1.0"
     exon            945..1021
                     /gene="Meis1"
                     /inference="alignment:Splign:2.1.0"
     exon            1022..1080
                     /gene="Meis1"
                     /inference="alignment:Splign:2.1.0"
     exon            1081..1170
                     /gene="Meis1"
                     /inference="alignment:Splign:2.1.0"
     exon            1171..1265
                     /gene="Meis1"
                     /inference="alignment:Splign:2.1.0"
     exon            1266..2480
                     /gene="Meis1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

ctggccttaaagaggatatattagaagttgaagaaggaagggaggcagagaggccgatggcgcaaaggtacgacgatctaccccattatgggggcatggatggagtaggcatcccctccacgatgtatggggacccgcatgcagccaggtctatgcagccggtccaccacctgaaccacgggcctcctctgcactctcatcagtacccgcacacagctcataccaacgccatggcccccagcatgggctcctcagtcaatgacgctttaaagagagataaagatgccatttatggacaccccctcttccctctcttagcactgatttttgagaaatgtgaattagctacttgtaccccccgcgagccgggggtggcgggcggggacgtctgctcgtcagagtcattcaatgaagatatagcggtgttcgccaaacagattcgtgcagaaaaacctctattctcttctaatccagaactggataacttgatgatccaagccatacaagtattaaggtttcatctgttggaattagagaaggtacacgaattatgtgacaatttctgccaccggtatattagctgtttgaaagggaaaatgcctatcgatttggtgatagatgatagagaaggcggatcaaaatcagacagtgaagatgtaacaagagcagcaaatctaactgaccagccctcttggaatagagaccatgatgacacggcatccactcgttcaggaggaaccccgggcccttccagcggtggccacacttcacacagtggggataacagcagtgagcaaggtgatggcttggacaacagtgtagcttcccccagcacaggtgacgatgatgaccctgataaggacaaaaagcgtcacaaaaagcgtggcatctttcccaaagtagccaccaatatcatgagggcgtggctgttccagcatctaacacacccttacccttctgaagagcagaaaaagcagttggcacaagatacgggactcaccatccttcaagtgaacaattggtttattaatgcgcggagaagaatagtgcagcccatgatagatcagtccaaccgagcagtcagccaagggacaccttataaccccgatggacagccaatgggaggttttgtaatggacggtcagcagcacatgggcatcagagcgccaggacctatgagtggaatgggcatgaatatgggcatggaggggcagtggcactacatgtaacgttcatctagttaaccaatcgaaagccagggggaaggctgcaaagtatgccaggggagtatgtagcccggggtggtccaatgggtgtgagtatgggacagccgagttatacccaagcccagatgcccccccatcctgctcagctgcgtcatgggccccccatgcatacgtacattcctggacatcctcaccaccccgcagtgatgatgcatggaggacagccccaccctggaatgccaatgtcagcgtcaagcccctcggttcttaatacaggagacccgacaatgagtggacaagtcatgaacattcacgctcagtagcttaagggaatatgcattgtctgcaatggtgactgatctcgaatcatgtctttttctgcaatgactatggagttccattcttgacatctactttggaccaaggagcatccctaattcttcatagggactcttaaaaatgcaggaaaaccaaccgaagtcaatttgggggacatgcaaaaataactatataagacattaaaagaacaaagagtgaaatattgtaaatgctattatactgttatccatattacgttgtttcttatagattttttaaaaaaaatgtgaaatttttccacactatgtgtgttgtttccatagctcttcacttcctccagaagcctccttacattaaaaagccttacagtcatcctgcaagggacaggaaggtctgatttgcaggatttttagagcattaaaataactatcaggcagaagaatctttcttctcgcctaggatttcagccatgtgcgcgctctctctctctctcctctctctctcttctcctctctctccctctctctagcctggggcttgaatttgcatgtctaattcatttactcaccatatttgaattggcctgaacagatgtaaatcgggaaggatgggaaaaactgcagtcacccaacaatgattaatcagctgttgcaggcagtgtcttaaggagactggtagaaggagccatggaaacccaaaggccgtgtgtttagaagcctaactgtcacgtcaagcgtcatcgtccccatgcgacaacaaccatcaccttatacatcacttcctgttttatgcagctcaaaaaaacatagactgaagatttatttttaatatgttgactttgtttctcagcaaagcattggtcatgtgtgtatttttccatagtcccaccttggagcatttatgtagacattgtaaataaattttgtgcaaaaaggaaaaaaaaaaaaaaaaaaaaaaaaaaa

//