2025-07-11 07:38:21, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001134702 2506 bp mRNA linear ROD 24-JUN-2024 DEFINITION Rattus norvegicus Meis homeobox 1 (Meis1), mRNA. ACCESSION NM_001134702 XM_001054791 XM_001054850 XM_001054906 XM_001054960 XM_001055028 XM_001070142 XM_001070196 XM_001070244 XM_001070286 XM_001070326 VERSION NM_001134702.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 2506) AUTHORS Yao,M.Z., Ge,X.Y., Liu,T., Huang,N., Liu,H., Chen,Y., Zhang,Z. and Hu,C.P. TITLE MEIS1 regulated proliferation and migration of pulmonary artery smooth muscle cells in hypoxia-induced pulmonary hypertension JOURNAL Life Sci 255, 117822 (2020) PUBMED 32450174 REMARK GeneRIF: MEIS1 regulated the proliferation and migration of pulmonary artery smooth muscle cells during hypoxia-induced pulmonary hypertension REFERENCE 2 (bases 1 to 2506) AUTHORS Zhang,Y., Si,Y. and Ma,N. TITLE Meis1 promotes poly (rC)-binding protein 2 expression and inhibits angiotensin II-induced cardiomyocyte hypertrophy JOURNAL IUBMB Life 68 (1), 13-22 (2016) PUBMED 26597775 REFERENCE 3 (bases 1 to 2506) AUTHORS Pandey,R., Yang,Y., Jackson,L. and Ahmed,R.P. TITLE MicroRNAs regulating meis1 expression and inducing cardiomyocyte proliferation JOURNAL Cardiovasc Regen Med 3 (2016) PUBMED 28111633 REFERENCE 4 (bases 1 to 2506) AUTHORS Jolma,A., Yin,Y., Nitta,K.R., Dave,K., Popov,A., Taipale,M., Enge,M., Kivioja,T., Morgunova,E. and Taipale,J. TITLE DNA-dependent formation of transcription factor pairs alters their binding specificity JOURNAL Nature 527 (7578), 384-388 (2015) PUBMED 26550823 REFERENCE 5 (bases 1 to 2506) AUTHORS Spieler,D., Kaffe,M., Knauf,F., Bessa,J., Tena,J.J., Giesert,F., Schormair,B., Tilch,E., Lee,H., Horsch,M., Czamara,D., Karbalai,N., von Toerne,C., Waldenberger,M., Gieger,C., Lichtner,P., Claussnitzer,M., Naumann,R., Muller-Myhsok,B., Torres,M., Garrett,L., Rozman,J., Klingenspor,M., Gailus-Durner,V., Fuchs,H., Hrabe de Angelis,M., Beckers,J., Holter,S.M., Meitinger,T., Hauck,S.M., Laumen,H., Wurst,W., Casares,F., Gomez-Skarmeta,J.L. and Winkelmann,J. TITLE Restless legs syndrome-associated intronic common variant in Meis1 alters enhancer function in the developing telencephalon JOURNAL Genome Res 24 (4), 592-603 (2014) PUBMED 24642863 REFERENCE 6 (bases 1 to 2506) AUTHORS Toresson,H., Parmar,M. and Campbell,K. TITLE Expression of Meis and Pbx genes and their protein products in the developing telencephalon: implications for regional differentiation JOURNAL Mech Dev 94 (1-2), 183-187 (2000) PUBMED 10842069 REFERENCE 7 (bases 1 to 2506) AUTHORS Jacobs,Y., Schnabel,C.A. and Cleary,M.L. TITLE Trimeric association of Hox and TALE homeodomain proteins mediates Hoxb2 hindbrain enhancer activity JOURNAL Mol Cell Biol 19 (7), 5134-5142 (1999) PUBMED 10373562 REFERENCE 8 (bases 1 to 2506) AUTHORS Knoepfler,P.S., Calvo,K.R., Chen,H., Antonarakis,S.E. and Kamps,M.P. TITLE Meis1 and pKnox1 bind DNA cooperatively with Pbx1 utilizing an interaction surface disrupted in oncoprotein E2a-Pbx1 JOURNAL Proc Natl Acad Sci U S A 94 (26), 14553-14558 (1997) PUBMED 9405651 REFERENCE 9 (bases 1 to 2506) AUTHORS Shen,W.F., Montgomery,J.C., Rozenfeld,S., Moskow,J.J., Lawrence,H.J., Buchberg,A.M. and Largman,C. TITLE AbdB-like Hox proteins stabilize DNA binding by the Meis1 homeodomain proteins JOURNAL Mol Cell Biol 17 (11), 6448-6458 (1997) PUBMED 9343407 REFERENCE 10 (bases 1 to 2506) AUTHORS Chang,C.P., Jacobs,Y., Nakamura,T., Jenkins,N.A., Copeland,N.G. and Cleary,M.L. TITLE Meis proteins are major in vivo DNA binding partners for wild-type but not chimeric Pbx proteins JOURNAL Mol Cell Biol 17 (10), 5679-5687 (1997) PUBMED 9315626 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC161984.1. On or before Sep 5, 2008 this sequence version replaced XM_001054960.1, XM_001055028.1, XM_001054850.1, XM_001054791.1, XM_001054906.1, XM_001070286.1, XM_001070326.1, XM_001070196.1, XM_001070244.1, XM_001070142.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC161984.1, SRR8487227.99997.1 [ECO:0000332] RNAseq introns :: mixed sample support SAMD00132261, SAMD00132262 [ECO:0006172] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..2506 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="14" /map="14q22" gene 1..2506 /gene="Meis1" /note="Meis homeobox 1" /db_xref="GeneID:686117" /db_xref="RGD:1585482" exon 1..68 /gene="Meis1" /inference="alignment:Splign:2.1.0" CDS 57..1229 /gene="Meis1" /note="Meis1, myeloid ecotropic viral integration site 1 homolog" /codon_start=1 /product="homeobox protein Meis1" /protein_id="NP_001128174.1" /db_xref="GeneID:686117" /db_xref="RGD:1585482" /translation="
MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDVTRAANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM"
misc_feature 378..632 /gene="Meis1" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:465140" misc_feature order(888..890,1017..1019,1026..1031,1038..1040) /gene="Meis1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 927..1043 /gene="Meis1" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:428673" exon 69..295 /gene="Meis1" /inference="alignment:Splign:2.1.0" exon 296..437 /gene="Meis1" /inference="alignment:Splign:2.1.0" exon 438..488 /gene="Meis1" /inference="alignment:Splign:2.1.0" exon 489..539 /gene="Meis1" /inference="alignment:Splign:2.1.0" exon 540..686 /gene="Meis1" /inference="alignment:Splign:2.1.0" exon 687..798 /gene="Meis1" /inference="alignment:Splign:2.1.0" exon 799..944 /gene="Meis1" /inference="alignment:Splign:2.1.0" exon 945..1021 /gene="Meis1" /inference="alignment:Splign:2.1.0" exon 1022..1080 /gene="Meis1" /inference="alignment:Splign:2.1.0" exon 1081..1170 /gene="Meis1" /inference="alignment:Splign:2.1.0" exon 1171..1265 /gene="Meis1" /inference="alignment:Splign:2.1.0" exon 1266..2480 /gene="Meis1" /inference="alignment:Splign:2.1.0" ORIGIN
ctggccttaaagaggatatattagaagttgaagaaggaagggaggcagagaggccgatggcgcaaaggtacgacgatctaccccattatgggggcatggatggagtaggcatcccctccacgatgtatggggacccgcatgcagccaggtctatgcagccggtccaccacctgaaccacgggcctcctctgcactctcatcagtacccgcacacagctcataccaacgccatggcccccagcatgggctcctcagtcaatgacgctttaaagagagataaagatgccatttatggacaccccctcttccctctcttagcactgatttttgagaaatgtgaattagctacttgtaccccccgcgagccgggggtggcgggcggggacgtctgctcgtcagagtcattcaatgaagatatagcggtgttcgccaaacagattcgtgcagaaaaacctctattctcttctaatccagaactggataacttgatgatccaagccatacaagtattaaggtttcatctgttggaattagagaaggtacacgaattatgtgacaatttctgccaccggtatattagctgtttgaaagggaaaatgcctatcgatttggtgatagatgatagagaaggcggatcaaaatcagacagtgaagatgtaacaagagcagcaaatctaactgaccagccctcttggaatagagaccatgatgacacggcatccactcgttcaggaggaaccccgggcccttccagcggtggccacacttcacacagtggggataacagcagtgagcaaggtgatggcttggacaacagtgtagcttcccccagcacaggtgacgatgatgaccctgataaggacaaaaagcgtcacaaaaagcgtggcatctttcccaaagtagccaccaatatcatgagggcgtggctgttccagcatctaacacacccttacccttctgaagagcagaaaaagcagttggcacaagatacgggactcaccatccttcaagtgaacaattggtttattaatgcgcggagaagaatagtgcagcccatgatagatcagtccaaccgagcagtcagccaagggacaccttataaccccgatggacagccaatgggaggttttgtaatggacggtcagcagcacatgggcatcagagcgccaggacctatgagtggaatgggcatgaatatgggcatggaggggcagtggcactacatgtaacgttcatctagttaaccaatcgaaagccagggggaaggctgcaaagtatgccaggggagtatgtagcccggggtggtccaatgggtgtgagtatgggacagccgagttatacccaagcccagatgcccccccatcctgctcagctgcgtcatgggccccccatgcatacgtacattcctggacatcctcaccaccccgcagtgatgatgcatggaggacagccccaccctggaatgccaatgtcagcgtcaagcccctcggttcttaatacaggagacccgacaatgagtggacaagtcatgaacattcacgctcagtagcttaagggaatatgcattgtctgcaatggtgactgatctcgaatcatgtctttttctgcaatgactatggagttccattcttgacatctactttggaccaaggagcatccctaattcttcatagggactcttaaaaatgcaggaaaaccaaccgaagtcaatttgggggacatgcaaaaataactatataagacattaaaagaacaaagagtgaaatattgtaaatgctattatactgttatccatattacgttgtttcttatagattttttaaaaaaaatgtgaaatttttccacactatgtgtgttgtttccatagctcttcacttcctccagaagcctccttacattaaaaagccttacagtcatcctgcaagggacaggaaggtctgatttgcaggatttttagagcattaaaataactatcaggcagaagaatctttcttctcgcctaggatttcagccatgtgcgcgctctctctctctctcctctctctctcttctcctctctctccctctctctagcctggggcttgaatttgcatgtctaattcatttactcaccatatttgaattggcctgaacagatgtaaatcgggaaggatgggaaaaactgcagtcacccaacaatgattaatcagctgttgcaggcagtgtcttaaggagactggtagaaggagccatggaaacccaaaggccgtgtgtttagaagcctaactgtcacgtcaagcgtcatcgtccccatgcgacaacaaccatcaccttatacatcacttcctgttttatgcagctcaaaaaaacatagactgaagatttatttttaatatgttgactttgtttctcagcaaagcattggtcatgtgtgtatttttccatagtcccaccttggagcatttatgtagacattgtaaataaattttgtgcaaaaaggaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]