2024-11-23 05:58:59, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS NM_001047880 1639 bp mRNA linear ROD 03-JUN-2024 DEFINITION Rattus norvegicus solute carrier family 25 member 15 (Slc25a15), mRNA; nuclear gene for mitochondrial product. ACCESSION NM_001047880 XM_001064456 XM_001064514 XM_001064627 XM_001064682 XM_224969 VERSION NM_001047880.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1639) AUTHORS Da Cruz,S., Xenarios,I., Langridge,J., Vilbois,F., Parone,P.A. and Martinou,J.C. TITLE Proteomic analysis of the mouse liver mitochondrial inner membrane JOURNAL J Biol Chem 278 (42), 41566-41571 (2003) PUBMED 12865426 REFERENCE 2 (bases 1 to 1639) AUTHORS Fiermonte,G., Dolce,V., David,L., Santorelli,F.M., Dionisi-Vici,C., Palmieri,F. and Walker,J.E. TITLE The mitochondrial ornithine transporter. Bacterial expression, reconstitution, functional characterization, and tissue distribution of two human isoforms JOURNAL J Biol Chem 278 (35), 32778-32783 (2003) PUBMED 12807890 REFERENCE 3 (bases 1 to 1639) AUTHORS Camacho,J.A., Rioseco-Camacho,N., Andrade,D., Porter,J. and Kong,J. TITLE Cloning and characterization of human ORNT2: a second mitochondrial ornithine transporter that can rescue a defective ORNT1 in patients with the hyperornithinemia-hyperammonemia-homocitrullinuria syndrome, a urea cycle disorder JOURNAL Mol Genet Metab 79 (4), 257-271 (2003) PUBMED 12948741 REFERENCE 4 (bases 1 to 1639) AUTHORS Morris,S.M. Jr. and Kepka-Lenhart,D. TITLE Hormonal induction of hepatic mitochondrial ornithine/citrulline transporter mRNA JOURNAL Biochem Biophys Res Commun 294 (4), 749-752 (2002) PUBMED 12061769 REMARK GeneRIF: Transcriptional Activation of ORNT1 mRNA by dexamethasone in hepatocytes. REFERENCE 5 (bases 1 to 1639) AUTHORS Tsujino,S., Kanazawa,N., Ohashi,T., Eto,Y., Saito,T., Kira,J. and Yamada,T. TITLE Three novel mutations (G27E, insAAC, R179X) in the ORNT1 gene of Japanese patients with hyperornithinemia, hyperammonemia, and homocitrullinuria syndrome JOURNAL Ann Neurol 47 (5), 625-631 (2000) PUBMED 10805333 REFERENCE 6 (bases 1 to 1639) AUTHORS Camacho,J.A., Obie,C., Biery,B., Goodman,B.K., Hu,C.A., Almashanu,S., Steel,G., Casey,R., Lambert,M., Mitchell,G.A. and Valle,D. TITLE Hyperornithinaemia-hyperammonaemia-homocitrullinuria syndrome is caused by mutations in a gene encoding a mitochondrial ornithine transporter JOURNAL Nat Genet 22 (2), 151-158 (1999) PUBMED 10369256 REFERENCE 7 (bases 1 to 1639) AUTHORS Indiveri,C., Tonazzi,A., Stipani,I. and Palmieri,F. TITLE The purified and reconstituted ornithine/citrulline carrier from rat liver mitochondria: electrical nature and coupling of the exchange reaction with H+ translocation JOURNAL Biochem J 327 (Pt 2) (Pt 2), 349-355 (1997) PUBMED 9359400 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CA339807.1, AY325139.1 and DY310527.1. On Jul 1, 2017 this sequence version replaced NM_001047880.2. ##Evidence-Data-START## CDS exon combination :: AY325139.1 [ECO:0000331] RNAseq introns :: partial sample support SAMD00132261, SAMD00132262 [ECO:0000350] ##Evidence-Data-END## ##RefSeq-Attributes-START## gene product(s) localized to mito. :: inferred from homology RefSeq Select criteria :: based on conservation, longest protein ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-60 CA339807.1 142-201 61-1078 AY325139.1 41-1058 1079-1639 DY310527.1 54-614 FEATURES Location/Qualifiers source 1..1639 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="16" /map="16q12.5" gene 1..1639 /gene="Slc25a15" /gene_synonym="Ab1-114; Ornt1" /note="solute carrier family 25 member 15" /db_xref="GeneID:306574" /db_xref="RGD:1311488" exon 1..115 /gene="Slc25a15" /gene_synonym="Ab1-114; Ornt1" /inference="alignment:Splign:2.1.0" CDS 61..1077 /gene="Slc25a15" /gene_synonym="Ab1-114; Ornt1" /note="ornithine transporter) member 15; solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 15" /codon_start=1 /product="mitochondrial ornithine transporter 1" /protein_id="NP_001041345.1" /db_xref="GeneID:306574" /db_xref="RGD:1311488" /translation="
MKSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKVKMQTFPDLYRGLTDCCLRTYSQVGFRGFYKGTSPALIANIAENSVLFMCYGFCQQVVRKVVGLDRQAKLSDLQNAAAGSFASAFAALVLCPTELVKCRLQTMYEMETSGKIAASQNTVWSVVKEIFRKDGPLGFYHGLSSTLLREVPGYFFFFGGYELSRSFFASGRSKDELGPIPLMLSGGFGGICLWLAVYPVDCIKSRIQVLSMTGKQTGLIRTFLSIVKNEGGYRLSESRLYDVSFVQPKTCLSGVHYVGILKLGLREGITALYSGLKPTMIRAFPANGALFLAYEYSRKLMMSQLEAC"
misc_feature 85..342 /gene="Slc25a15" /gene_synonym="Ab1-114; Ornt1" /note="Mitochondrial carrier protein; Region: Mito_carr; pfam00153" /db_xref="CDD:395101" misc_feature <424..654 /gene="Slc25a15" /gene_synonym="Ab1-114; Ornt1" /note="Mitochondrial carrier protein; Region: Mito_carr; pfam00153" /db_xref="CDD:395101" misc_feature 673..1056 /gene="Slc25a15" /gene_synonym="Ab1-114; Ornt1" /note="Mitochondrial carrier protein; Region: Mito_carr; pfam00153" /db_xref="CDD:395101" exon 116..374 /gene="Slc25a15" /gene_synonym="Ab1-114; Ornt1" /inference="alignment:Splign:2.1.0" exon 375..512 /gene="Slc25a15" /gene_synonym="Ab1-114; Ornt1" /inference="alignment:Splign:2.1.0" exon 513..682 /gene="Slc25a15" /gene_synonym="Ab1-114; Ornt1" /inference="alignment:Splign:2.1.0" exon 683..841 /gene="Slc25a15" /gene_synonym="Ab1-114; Ornt1" /inference="alignment:Splign:2.1.0" exon 842..952 /gene="Slc25a15" /gene_synonym="Ab1-114; Ornt1" /inference="alignment:Splign:2.1.0" exon 953..1615 /gene="Slc25a15" /gene_synonym="Ab1-114; Ornt1" /inference="alignment:Splign:2.1.0" ORIGIN
ggatatgtggttcacatccttccctccagagaattgccttcaacagaaaccagtaacgccatgaagtccaatccagccatccaagctgccatcgacctcacggcaggggccgcagggggcacagcatgcgtcctgactgggcagcccttcgacaccatgaaggtgaagatgcagacatttccagacctctaccgcggcctcactgactgctgcctgaggacctactcccaggtgggcttcagaggcttctacaaggggaccagccccgcactgatcgccaatatcgcagagaactcggtgcttttcatgtgttacggcttctgccagcaggtggtccgcaaagtggttggattggaccggcaggcaaaactgagtgaccttcagaacgcagctgctggctcctttgcttctgcttttgccgctctggttctctgccctacagagcttgtgaagtgccggctacagaccatgtatgaaatggagacgtcgggaaagatagcggccagccagaatacagtttggtcagtcgtgaaggaaatcttcaggaaggatggccccctgggtttctaccatggcctctcaagcactttacttcgagaagtaccaggctatttcttcttctttggtggctatgaactgagcagatcatttttcgcatcagggagatccaaagatgaactgggtcctatcccgctcatgctaagtggtggatttggtgggatttgcctgtggcttgctgtgtatccggtggattgtatcaaatctagaattcaagttctttctatgaccggaaagcagacgggactcatcagaaccttcctgagtatcgtaaagaatgaaggaggatacagactttcagagtcacggctctatgacgtcagcttcgtgcagccaaagacctgtctttctggtgtccactatgtaggcatcttaaaactagggttacgggaaggaataacagccttgtattctggactgaaacccaccatgatccgcgctttccctgccaacggggcactgtttttggcctacgagtatagcaggaagttgatgatgagccaactggaagcatgctgaagtgtcctggtgtgcctggagtcaaggcaggcgtttagcgactggttaactcagggtttcacggagtacaagaacaatgtggaattatgtgattcattgggactttgtccttgtcttcccttcttctattcaaagtcttggattttgtggatggtcctctgttctacacagtgtaatttctgcctgttactgaaccaaaacagaaaagtcactgttctcgtccttggcctcatgcacaggggagctggtggcctcatgcactggctttatgtaccttgtgcaggccctgttcctctcaggataacttccgtggaagtcagctgtacacatgcaatttagatggtcctgtcgtgaggaaaacaaatttttgttctatgtttaactgcaaacggtgaccaatttttacgtaggtggttgtaaatgattgcctaacacatcctagctagagggccgctgctaaaagccgctgagcctgtgcactaagaggttagagcttttgactttttgtggtatattaaagctaaaatacccatctataaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]