GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-02 10:18:40, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_001015020            1410 bp    mRNA    linear   ROD 20-MAR-2023
DEFINITION  Rattus norvegicus TGFB-induced factor homeobox 1 (Tgif1), mRNA.
ACCESSION   NM_001015020 XM_237524
VERSION     NM_001015020.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1410)
  AUTHORS   Li J, Chen L, Sun L, Chen H, Sun Y, Jiang C and Cheng B.
  TITLE     Silencing of TGIF1 in bone mesenchymal stem cells applied to the
            post-operative rotator cuff improves both functional and histologic
            outcomes
  JOURNAL   J Mol Histol 46 (3), 241-249 (2015)
   PUBMED   25782868
  REMARK    GeneRIF: Silencing TGIF1 in bone mesenchymal stem cells may improve
            tendon-to-bone insertion site healing.
REFERENCE   2  (bases 1 to 1410)
  AUTHORS   Chen,L., Jiang,C., Tiwari,S.R., Shrestha,A., Xu,P., Liang,W.,
            Sun,Y., He,S. and Cheng,B.
  TITLE     TGIF1 Gene Silencing in Tendon-Derived Stem Cells Improves the
            Tendon-to-Bone Insertion Site Regeneration
  JOURNAL   Cell Physiol Biochem 37 (6), 2101-2114 (2015)
   PUBMED   26599628
  REMARK    GeneRIF: study shows that the tendon-derived stem cell modified
            with TGIF1 gene silencing has promising effects on tendon-to-bone
            healing which can be further explored as a therapeutic tool in
            regenerative medicine
REFERENCE   3  (bases 1 to 1410)
  AUTHORS   Chio CC, Chang CP, Lin MT, Su FC, Yang CZ, Tseng HY, Liu ZM and
            Huang HS.
  TITLE     Involvement of TG-interacting factor in microglial activation
            during experimental traumatic brain injury
  JOURNAL   J Neurochem 131 (6), 816-824 (2014)
   PUBMED   25319900
  REMARK    GeneRIF: the increase of transforming growth-interacting factor
            levels in the activated microglia of the pericontusional cortex of
            rats with traumatic brain injury
REFERENCE   4  (bases 1 to 1410)
  AUTHORS   Davis H, Lewis A, Spencer-Dene B, Tateossian H, Stamp G, Behrens A
            and Tomlinson I.
  TITLE     FBXW7 mutations typically found in human cancers are distinct from
            null alleles and disrupt lung development
  JOURNAL   J Pathol 224 (2), 180-189 (2011)
   PUBMED   21503901
  REMARK    Erratum:[J Pathol. 2012 Jan;226(1):144]
REFERENCE   5  (bases 1 to 1410)
  AUTHORS   Powers SE, Taniguchi K, Yen W, Melhuish TA, Shen J, Walsh CA,
            Sutherland AE and Wotton D.
  TITLE     Tgif1 and Tgif2 regulate Nodal signaling and are required for
            gastrulation
  JOURNAL   Development 137 (2), 249-259 (2010)
   PUBMED   20040491
REFERENCE   6  (bases 1 to 1410)
  AUTHORS   Dai C and Liu Y.
  TITLE     Hepatocyte growth factor antagonizes the profibrotic action of
            TGF-beta1 in mesangial cells by stabilizing Smad transcriptional
            corepressor TGIF
  JOURNAL   J Am Soc Nephrol 15 (6), 1402-1412 (2004)
   PUBMED   15153551
  REMARK    GeneRIF: Smad transcriptional corepressor TGIF is stabilized by
            hepatocyte growth factor in mesangial cells, which antagonizes the
            profibrotic action of TGF-beta1 [TGIF]
REFERENCE   7  (bases 1 to 1410)
  AUTHORS   Lecker SH, Jagoe RT, Gilbert A, Gomes M, Baracos V, Bailey J, Price
            SR, Mitch WE and Goldberg AL.
  TITLE     Multiple types of skeletal muscle atrophy involve a common program
            of changes in gene expression
  JOURNAL   FASEB J 18 (1), 39-51 (2004)
   PUBMED   14718385
REFERENCE   8  (bases 1 to 1410)
  AUTHORS   Rombouts K, Niki T, Greenwel P, Vandermonde A, Wielant A, Hellemans
            K, De Bleser P, Yoshida M, Schuppan D, Rojkind M and Geerts A.
  TITLE     Trichostatin A, a histone deacetylase inhibitor, suppresses
            collagen synthesis and prevents TGF-beta(1)-induced fibrogenesis in
            skin fibroblasts
  JOURNAL   Exp Cell Res 278 (2), 184-197 (2002)
   PUBMED   12169274
REFERENCE   9  (bases 1 to 1410)
  AUTHORS   Yang Y, Hwang CK, D'Souza UM, Lee SH, Junn E and Mouradian MM.
  TITLE     Three-amino acid extension loop homeodomain proteins Meis2 and TGIF
            differentially regulate transcription
  JOURNAL   J Biol Chem 275 (27), 20734-20741 (2000)
   PUBMED   10764806
REFERENCE   10 (bases 1 to 1410)
  AUTHORS   Gripp KW, Wotton D, Edwards MC, Roessler E, Ades L, Meinecke P,
            Richieri-Costa A, Zackai EH, Massague J, Muenke M and Elledge SJ.
  TITLE     Mutations in TGIF cause holoprosencephaly and link NODAL signalling
            to human neural axis determination
  JOURNAL   Nat Genet 25 (2), 205-208 (2000)
   PUBMED   10835638
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC091264.1.
            
            On Apr 20, 2005 this sequence version replaced XM_237524.3.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC091264.1, BC127461.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00132291, SAMEA5756307
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1410
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="9"
                     /map="9q38"
     gene            1..1410
                     /gene="Tgif1"
                     /gene_synonym="Tfig; Tgif"
                     /note="TGFB-induced factor homeobox 1"
                     /db_xref="GeneID:316742"
                     /db_xref="RGD:1310517"
     exon            1..106
                     /gene="Tgif1"
                     /gene_synonym="Tfig; Tgif"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    1..3
                     /gene="Tgif1"
                     /gene_synonym="Tfig; Tgif"
                     /note="upstream in-frame stop codon"
     CDS             49..912
                     /gene="Tgif1"
                     /gene_synonym="Tfig; Tgif"
                     /note="TG interacting factor 1"
                     /codon_start=1
                     /product="homeobox protein TGIF1"
                     /protein_id="NP_001015020.1"
                     /db_xref="GeneID:316742"
                     /db_xref="RGD:1310517"
                     /translation="
MIYTSRRCALAGSGWPSRHGVVAAASGSDSEDEDSMDSPLDLSSSAASGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISEASSIEAAMGIKNFMPTLEESPFHSCVVGPNPTLGRPVSPKPPSPGPILARPSVICHTTVTALKDGPFSLCQAVSVGHSTDVQQVAPSNFTDASLRYPEDTCKSGPSPNPQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKQAAEMELQAKLTA"
     misc_feature    order(199..213,217..219,277..279,295..297,334..336,
                     340..345,352..357,361..369)
                     /gene="Tgif1"
                     /gene_synonym="Tfig; Tgif"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(205..207,214..216,343..345,352..357,364..366)
                     /gene="Tgif1"
                     /gene_synonym="Tfig; Tgif"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    253..369
                     /gene="Tgif1"
                     /gene_synonym="Tfig; Tgif"
                     /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920"
                     /db_xref="CDD:428673"
     exon            107..336
                     /gene="Tgif1"
                     /gene_synonym="Tfig; Tgif"
                     /inference="alignment:Splign:2.1.0"
     exon            337..1389
                     /gene="Tgif1"
                     /gene_synonym="Tfig; Tgif"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
tgatctcagaacccggccagcgcgctccggcttcccaactgcctcgaaatgatttacacgagcaggaggtgtgcattggcggggtccggctggccttcgcgtcacggtgttgttgcagcagcatccggcagtgactctgaggatgaagacagtatggacagtcccttggacctttcatcgtcagcggcctctggcaagagaaggaggagaggcaatctgcccaaagagtccgtccagattcttcgagactggctgtatgaacacagatacaacgcatacccctcagagcaagagaaagccctgctgtcgcagcagacacacctgtccacactacaggtctgtaactggttcatcaacgcccgtcgcaggctccttcctgacatgctgagaaaggatggcaaagacccaaatcagttcaccatttcccgccgaggggccaagatctcagaagctagctctattgaagctgcaatgggtatcaaaaacttcatgccaactctagaagagagcccatttcattcctgcgtagttggacccaacccaaccctagggagaccagtgtctcccaaacctccctccccgggacccatcttggctcgcccctcagtgatctgccataccactgtgactgcattgaaggacgggcctttctctctctgccaggcagtcagtgtgggacatagtacagatgtacagcaggtagcacccagcaactttacagacgcctctctcaggtacccagaggacacttgcaaatctggacccagtccaaatcctcagagtggtcttttcaacactcctcccccgactccgccagacctcaaccaggattttagtggatttcagctcctggtggacgttgcgctcaagcaggcagcagagatggagcttcaggccaaactcacagcttaaccgagtgtcaaacaaaacagttctccaaaatacggtcctgaattgccgggggtgatggcaagagatgcattattttatatattttcctattaatatttgcacatgggattgctcaaacgaagcttcctgttactaagatgtcttcaatggaatagtcattccaagaactgcagactaaagctactgtagaaacagagggttttcttttcgaatgtttcttggtagtttctcataatgtgagacgttcccagtatcatgtgatcttctcctcccaactcctttttttttttttcaagactgtgcaatacttagaagcccttgtgcctctctgttcccatgtggaacatgaccccacatacagtctaatgaataaactttcagttttttgtttgtttgtttttttttatagattcaagcaagtatgaatctagttgttggatacctttttcatgatgtaataaagtattttctttaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]