2025-04-20 10:46:12, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001007598 723 bp mRNA linear ROD 03-APR-2024 DEFINITION Rattus norvegicus ribosomal protein L9 (Rpl9), mRNA. ACCESSION NM_001007598 XM_341213 VERSION NM_001007598.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 723) AUTHORS Zanivan,S., Maione,F., Hein,M.Y., Hernandez-Fernaud,J.R., Ostasiewicz,P., Giraudo,E. and Mann,M. TITLE SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers JOURNAL Mol Cell Proteomics 12 (12), 3599-3611 (2013) PUBMED 23979707 REFERENCE 2 (bases 1 to 723) AUTHORS Anger,A.M., Armache,J.P., Berninghausen,O., Habeck,M., Subklewe,M., Wilson,D.N. and Beckmann,R. TITLE Structures of the human and Drosophila 80S ribosome JOURNAL Nature 497 (7447), 80-85 (2013) PUBMED 23636399 REFERENCE 3 (bases 1 to 723) AUTHORS de Mateo,S., Castillo,J., Estanyol,J.M., Ballesca,J.L. and Oliva,R. TITLE Proteomic characterization of the human sperm nucleus JOURNAL Proteomics 11 (13), 2714-2726 (2011) PUBMED 21630459 REFERENCE 4 (bases 1 to 723) AUTHORS Kuo,J.C., Han,X., Hsiao,C.T., Yates,J.R. 3rd and Waterman,C.M. TITLE Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for beta-Pix in negative regulation of focal adhesion maturation JOURNAL Nat Cell Biol 13 (4), 383-393 (2011) PUBMED 21423176 REFERENCE 5 (bases 1 to 723) AUTHORS Ghosh,D., Lippert,D., Krokhin,O., Cortens,J.P. and Wilkins,J.A. TITLE Defining the membrane proteome of NK cells JOURNAL J Mass Spectrom 45 (1), 1-25 (2010) PUBMED 19946888 REFERENCE 6 (bases 1 to 723) AUTHORS Odintsova,T.I., Muller,E.C., Ivanov,A.V., Egorov,T.A., Bienert,R., Vladimirov,S.N., Kostka,S., Otto,A., Wittmann-Liebold,B. and Karpova,G.G. TITLE Characterization and analysis of posttranslational modifications of the human large cytoplasmic ribosomal subunit proteins by mass spectrometry and Edman sequencing JOURNAL J Protein Chem 22 (3), 249-258 (2003) PUBMED 12962325 REFERENCE 7 (bases 1 to 723) AUTHORS Angelastro,J.M., Torocsik,B. and Greene,L.A. TITLE Nerve growth factor selectively regulates expression of transcripts encoding ribosomal proteins JOURNAL BMC Neurosci 3, 3 (2002) PUBMED 11922865 REFERENCE 8 (bases 1 to 723) AUTHORS Monach,P.A., Meredith,S.C., Siegel,C.T. and Schreiber,H. TITLE A unique tumor antigen produced by a single amino acid substitution JOURNAL Immunity 2 (1), 45-59 (1995) PUBMED 7600302 REFERENCE 9 (bases 1 to 723) AUTHORS Suzuki,K., Olvera,J. and Wool,I.G. TITLE The primary structure of rat ribosomal protein L9 JOURNAL Gene 93 (2), 297-300 (1990) PUBMED 2227441 REFERENCE 10 (bases 1 to 723) AUTHORS Tsurugi,K., Collatz,E., Wool,E.G. and Lin,A. TITLE Isolation of eukaryotic ribosomal proteins. Purification and characterization of the 60 S ribosomal subunit proteins L4, L5, L7, L9, L11, L12, L13, L21, L22, L23, L26, L27, L30, L33, L35', L37, and L39 JOURNAL J Biol Chem 251 (24), 7940-7946 (1976) PUBMED 1002715 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BC060589.1 and BC086561.1. On Apr 13, 2007 this sequence version replaced NM_001007598.2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC060589.1, CB314568.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMD00132261, SAMD00132262 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-18 BC060589.1 5-22 19-723 BC086561.1 1-705 FEATURES Location/Qualifiers source 1..723 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="14" /map="14p11" gene 1..723 /gene="Rpl9" /note="ribosomal protein L9" /db_xref="GeneID:29257" /db_xref="RGD:62049" exon 1..23 /gene="Rpl9" /inference="alignment:Splign:2.1.0" exon 24..70 /gene="Rpl9" /inference="alignment:Splign:2.1.0" CDS 25..603 /gene="Rpl9" /note="60S ribosomal protein L9" /codon_start=1 /product="large ribosomal subunit protein uL6" /protein_id="NP_001007599.3" /db_xref="GeneID:29257" /db_xref="RGD:62049" /translation="
MKTILSNQTVDIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKWWGNRKELATVRTICSHVQNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRTGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQPDE"
misc_feature 25..591 /gene="Rpl9" /note="60S ribosomal protein L6; Provisional; Region: PTZ00027" /db_xref="CDD:240234" misc_feature 385..387 /gene="Rpl9" /note="N6-acetyllysine. /evidence=ECO:0000250|UniProtKB:P32969; propagated from UniProtKB/Swiss-Prot (P17077.1); acetylation site" exon 71..186 /gene="Rpl9" /inference="alignment:Splign:2.1.0" exon 187..282 /gene="Rpl9" /inference="alignment:Splign:2.1.0" exon 283..415 /gene="Rpl9" /inference="alignment:Splign:2.1.0" exon 416..496 /gene="Rpl9" /inference="alignment:Splign:2.1.0" exon 497..611 /gene="Rpl9" /inference="alignment:Splign:2.1.0" exon 612..690 /gene="Rpl9" /inference="alignment:Splign:2.1.0" ORIGIN
ctctttgccccatctactgcgagaatgaagaccattctcagcaatcagactgtcgacattccagaaaatgtcgacatcactctgaaggggcgcacagtcattgtgaagggccccagaggaactctgaggagggacttcaatcacatcaatgtagagctgagtcttcttggaaagaaaaagaaaaggctccgtgttgacaagtggtggggtaacaggaaggaactggccactgtcagaaccatctgcagtcatgttcagaacatgatcaagggtgtgacactgggcttccgttacaagatgaggtctgtgtatgctcacttccctatcaacgtcgttattcaggagaatgggtctctggttgaaatccgaaatttcttgggtgaaaaatacatccggagggttcggatgaggacaggtgttgcttgttctgtctctcaagcccagaaggatgagttaatccttgaaggaaatgatattgaacttgtttcaaattcagcggctctgattcagcaagccacaacagttaaaaacaaggatatcaggaagtttttggatggcatctatgtttctgagaagggaaccgtccagcagcctgacgaatgagacctcagtttcctagcttcagaaacaagatcctgataacaagtacagtttgggctctgtggaaacaataaaagacttatatattgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]